KEGG   Cynara cardunculus var. scolymus (artichoke): 112520747Help
Entry
112520747         CDS       T05604                                 

Definition
(RefSeq) lysosomal beta glucosidase-like
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav00460  Cyanoamino acid metabolism
ccav00500  Starch and sucrose metabolism
ccav00940  Phenylpropanoid biosynthesis
ccav01100  Metabolic pathways
ccav01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    112520747
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    112520747
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    112520747
Enzymes [BR:ccav01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     112520747
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C
Motif
Other DBs
NCBI-GeneID: 112520747
NCBI-ProteinID: XP_024985030
Position
LG 11
AA seq 637 aa AA seqDB search
MAKRSPFGLVMLVICCWTAMSAAESMKYKDPKQPINVRIKDLMERMTLEEKIGQMTQIDR
SVASPDVMQKYSIGSILSGGGSVPANRASPETWINMVNEFQKGSLASRLGIPMIYGIDAV
HGNNNVYNATIFPHNVGLGVTRDPELVKKIGVATALEVRATGINYAFAPCIAVCRDPRWG
RCFESYSEDPTIVRAMTELIPGLQGDIPTNSEKGVPFVGGQEKVAACAKHFVGDGGTTKG
INENNTVISQHGLFSIHMPAYYDSVLKGVATIMISYSSLNGVKMHGDQELITYFLKNTVK
FRGFVISDWQGIDRLTDPPHANYTWSILKSVEAGLDMIMVPYNYTEFIVGLTYLAKNKFI
PMSRIDDAVRRILRVKFVMGLFENPLADLSMAKYLGIQEHRDLAREAVRKSLVLLKNGKS
GNTPLLPLPKKSTKILVSGTHANDIGNQCGGWTIEWHGQSGNITPGTTILSAVKNTVDST
TEVVYQENPTPEFIKSNNFSYAIVVTGEYPYSETVGDSLNLTIPDPGPTTITNVCGAVRC
VVVLISGRPVVLEPYVSSMDALVAAWLPGTEGQGVADVLYGDYGFTGKLARTWFKTVDQL
PMNVGDPHYDPLYPFGYGLTTEAVGMKNKLLSESESE
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaacgttcaccatttggtttggtgatgcttgtgatctgttgttggactgctatg
tctgcagcagaaagcatgaaatataaagacccgaaacaacccataaatgttcgaataaag
gatttgatggaacgaatgactttggaggagaaaatcggccaaatgacacagatcgacaga
tctgtagcttcacctgatgtaatgcagaaatactccattgggagtatattgagcggtgga
gggagtgttccggccaacagggcttccccggagacatggattaatatggtaaacgagttt
caaaaagggtcgttggcttctcgtttagggataccgatgatttacgggattgatgctgtc
catggcaacaacaatgtctacaatgccaccatctttcctcataacgttggtcttggtgta
acaagggatcctgagctcgtcaaaaaaatcggagttgcaactgctctcgaagtcagagca
acgggaattaactatgcatttgcaccttgtatcgcggtttgtcgagatccaagatggggt
cgttgcttcgaaagctatagtgaagatcccacaattgttcgcgccatgaccgagcttata
cctggactacagggagatattcctactaatagcgaaaaaggcgtcccttttgttggcgga
caagaaaaggtagcggcgtgtgccaaacacttcgtcggtgatggtggcacaacgaaaggc
atcaatgaaaacaacaccgtcataagccagcacggattattcagcattcatatgccggca
tactacgattcggtactcaaaggcgttgcaacgatcatgatctcctactcgagcttgaat
ggagttaaaatgcatggagatcaggaactcatcacttacttcttgaaaaacactgtcaaa
ttcagagggttcgttatttcggattggcaaggtatcgatcgattgacggatccgcctcac
gctaactacacttggtcgatactaaagagtgtcgaggctggccttgatatgatcatggta
ccttacaactatacagaattcatcgttgggttgacttatttagcgaagaataagttcatc
ccgatgagtcgaatcgatgatgcagttaggaggattttaagggtgaagttcgtgatgggt
ctgtttgagaacccgttggcagatctcagcatggctaaataccttggaattcaggagcac
agagacctggctagggaagccgtaagaaaatcgctagtcttgctgaagaacgggaagtcc
ggcaacacgccccttcttcccctcccgaaaaaatcgaccaaaatactagtttcaggtact
catgccaacgacatcggtaaccagtgcggtggctggaccatcgagtggcacggccaaagc
ggaaatatcacaccgggtaccacaattctatcggccgtaaagaacacagtcgactcgaca
accgaagtcgtgtatcaagaaaacccgactcctgaatttataaagtccaataatttctcg
tacgccatcgttgtaactggcgagtacccatactcagagacggttggagacagtttgaat
ctaacgattcctgatccaggcccgaccacaatcacaaatgtatgtggggcggtgaggtgc
gttgttgtgctgatttcaggacgaccggttgtgcttgaaccgtatgtttctagcatggat
gcactggtggcggcttggcttccgggaaccgaaggccaaggcgttgctgatgttctgtat
ggtgattatggttttacgggcaaacttgcgaggacctggttcaagacggttgatcagctc
ccgatgaacgttggtgatccacattacgatccattgtacccattcggatacgggcttacg
accgaagctgtaggtatgaagaacaagcttctaagtgagtcggagagtgagtag

DBGET integrated database retrieval system