KEGG   Cynara cardunculus var. scolymus (artichoke): 112521989Help
Entry
112521989         CDS       T05604                                 

Definition
(RefSeq) probable glutathione peroxidase 2
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav00480  Glutathione metabolism
ccav00590  Arachidonic acid metabolism
ccav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    112521989
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    112521989
Enzymes [BR:ccav01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     112521989
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin TM231
Motif
Other DBs
NCBI-GeneID: 112521989
NCBI-ProteinID: XP_024986793
Position
LG 11
AA seq 202 aa AA seqDB search
MASTTVANLTPFLLVGLAFFLFYRHPSSPLTLNMAQEISKSVHDFTVKDIRGNEVPLSSY
KGKVLLIVNVASKCGLTESNYKELNILYQKYKNQDFEILAFPCNQFLWQEPGTNEEIQET
VCTNFKAEFPIFDKIEVNGNNAAPLYKFLKSEKGGFLVDGIKWNFTKFLVNKEGKVIERY
GPRTPPLEIEKDIQNLLQSSSS
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctacgacagtcgcgaatttgacgccttttcttctcgttggtctcgccttcttc
ttgttttacagacacccatcttctcccctcactttaaacatggcgcaagaaatctccaaa
tccgttcacgacttcacagttaaggatatccgcggaaacgaagtgcccttgagctcttac
aaggggaaggttcttttgatcgtcaatgttgcatcaaaatgtggattaacagagtcaaac
tacaaagaattgaacatattataccaaaaatacaaaaatcaagattttgaaatcttggct
tttccttgcaaccaatttctttggcaagaaccgggaacaaatgaagaaattcaggagacg
gtatgcacgaatttcaaagcggagttcccaatatttgataagattgaagtaaacggaaac
aatgcagcacccctctacaagttcttaaaatcagagaaaggtggtttcttggttgatggc
atcaaatggaacttcaccaagttcttggtgaacaaagaagggaaggttatcgaaagatat
ggccctcggaccccacctcttgaaatcgagaaagacattcaaaatctgctacaatcatca
tcttcttga

DBGET integrated database retrieval system