KEGG   Cynara cardunculus var. scolymus (artichoke): 112521995
Entry
112521995         CDS       T05604                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav00100  Steroid biosynthesis
ccav01100  Metabolic pathways
ccav01110  Biosynthesis of secondary metabolites
Module
ccav_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    112521995
Enzymes [BR:ccav01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     112521995
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 OPA3
Other DBs
NCBI-GeneID: 112521995
NCBI-ProteinID: XP_024986803
Position
LG 11
AA seq 369 aa
MDFSSLLNSFIPSWNSVGLLLGFFSYLGIAGSILPGKLVPGASLADGTRLHYRCNGLLSL
LLLVGLLVIGAWMDYVSPTAISDRGCELLSTTFIFSVVATLLLYVAGCKSSDRSSSLKPH
ITGNIIDDWWFGIQLNPNFMGVDLKFFFVRAGMMGWLLINLSVLAKSFQDANLSHSMILY
QLFCVIYIMDYFFYEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLNNKVDLT
IAAVIANCCVFVIGYVVFRGANKQKHDFKKNPKALIWGRPPNVIGGKLLVSGYWGIARHC
NYLGDLLLALSFSLPCGMSSPVPYFYPIYLLILLIWRERRDEARCAEKYKDVWEKYRRAV
PWRILPYIY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatttcagttcccttctcaactccttcattccttcttggaattctgttggtttatta
ctgggattcttcagttacttggggattgctggatctattttacctggaaaacttgttcct
ggagcgagtttagctgatggaactagactccattatcgctgcaatgggttgctatcactt
cttttgctggttggactactagtgattggagcttggatggattatgtatcacccactgca
atatctgatcgggggtgtgagcttctatcaacaacttttatcttcagtgttgttgccacg
ttgttactttatgtggctggctgcaaatccagtgaccgaagttcttctctcaaaccccac
attactggaaacataattgatgactggtggtttgggatacagctaaatcctaacttcatg
ggcgttgacctcaaatttttcttcgtcagagctggaatgatgggatggttgctcatcaat
ctttcagtgcttgcaaaatctttccaagatgccaacttgagccattcaatgatcctctac
cagctattttgtgtgatctacattatggactacttcttttatgaggaatacatgacatct
acatgggatataattgcagagagattgggcttcatgctagtatttggagatctagtctgg
atccccttcacgtttagcattcagggttggtggcttctgaataacaaggtggaccttaca
attgccgcagttattgcaaattgctgtgtgtttgtgattgggtatgtggtcttcagagga
gctaacaagcaaaagcatgattttaagaagaatcccaaagcactaatatggggtaggccc
ccaaatgtcattggggggaaattgctggtttctggctattggggaatagcaaggcactgt
aattatcttggagatctgttattggcattatccttcagcttaccctgtggaatgagttct
ccggttccatacttctacccgatatatcttctgattctgttgatatggcgagagagaaga
gacgaagctcgatgtgcagagaagtacaaagatgtgtgggagaaataccgcagggctgtc
ccctggaggattctgccgtacatttactag

DBGET integrated database retrieval system