KEGG   Cynara cardunculus var. scolymus (artichoke): 112522399Help
Entry
112522399         CDS       T05604                                 

Definition
(RefSeq) sphingosine kinase 2-like isoform X1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav00600  Sphingolipid metabolism
ccav01100  Metabolic pathways
Module
ccav_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    112522399
Enzymes [BR:ccav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     112522399
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat Tim54
Motif
Other DBs
NCBI-GeneID: 112522399
NCBI-ProteinID: XP_024987260
Position
LG 12
AA seq 514 aa AA seqDB search
MLTCDPSAINPTTIEGFVATPARHPHSLRNHHTPTMEQQPIVSDEVFVNGGKATVTLSTD
GMLRWFDRGVLLRCLSVEKEVLGLSTTGHLITIRALVETGSDDGWCLGSRGGGSLVRKSF
IFEAVSEDSLRNLCEKIQGYIDSLGRPKKLFIFVNPFGGRKSASKIFNYDVKPILEDANI
EYTMQETKYQLHAKEVSRSLDLTKYDGIICVSGDGILVEVMNGLLEREDWAAALKMPLGV
IPAGTGNGMIKSLLDSVGEPCTAAHAILAAIRGHKRSLDVATIWQGETKFFSVLMLAWGL
IADIDIESEKYRWMGSARISFYALKRILRLREYNGSISFVPAPGFEDVGEPSGSCVDSME
PLKPWQHGYQGPKVDLENLNWRKLDGPFVSVWLHNVPWGAENTMAAPDAKFGDGYLDLIV
IRQCPKLTLISLMSKLNDGGHVKSPYVVYMKVKAVILEPGSRTDKSMKEGIIDSDGEVLA
RGKGTYKSNLKSWMVYKKLQVVVDQGLATLFTPV
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgttgacttgcgatccttctgcgataaatccaactacgatcgagggatttgttgccacc
cccgcacgccaccctcattcccttcgcaaccaccacactccgacgatggaacaacaacct
atagtctccgatgaagtatttgtcaacggtggtaaagcaacagtgacgctctccactgac
gggatgctccggtggtttgatcgaggcgtacttcttcggtgcttgtctgtagagaaggaa
gttcttggattgtcaacgaccggacatctgatcacaattagggcacttgtagagaccggt
agtgacgacggatggtgcctcggaagtagagggggagggagtttggtgaggaagagcttc
atatttgaggcggtgtcggaggattcattacggaacttgtgcgagaagattcaaggatac
atcgattcgttaggtcgaccaaagaagctgtttatatttgttaatccatttggtgggagg
aaatctgcttccaagatttttaactatgatgtaaaaccgatacttgaggatgctaatatc
gaatatacgatgcaagaaaccaaatatcagcttcatgcaaaagaagtttctcgttcattg
gaccttacaaagtatgatggtatcatttgtgttagtggggatggcatattggttgaggtt
atgaatggattgcttgaaagagaagactgggcagctgcactgaagatgcctcttggagtc
atacctgcaggtacggggaatggcatgataaaatcccttttagattcagtcggcgagcca
tgcacagctgctcatgcaattcttgctgcaattcgagggcataaacgctctctggatgta
gctacaatctggcaaggggagaccaaattttttagtgtcttgatgcttgcatggggacta
atagcagatatagacatcgagtcagaaaagtatcggtggatgggaagtgctcgaataagt
ttctatgctcttaaacgaattttacggctgcgggaatataatggcagtatatcttttgta
cctgcacccggctttgaagatgtaggagagccaagtggttcatgtgttgattctatggag
cctcttaagccttggcagcatgggtaccagggtcccaaggttgatttggagaatttaaat
tggagaaagcttgatggtccgtttgtttctgtttggcttcataatgttccttggggtgct
gaaaacaccatggcagcgcctgatgccaagtttggagatggctatttggacttgattgta
attcggcaatgcccaaaattaaccttgatatccttgatgtctaaattgaacgacggaggt
cacgtaaaatctccatacgttgtgtacatgaaggtgaaagccgtgatcttggagcctggt
tcacgaacggataagtcgatgaaggaagggatcatagattcggatggggaagtgttggca
agagggaaaggaacatacaagtccaacctaaaatcctggatggtatacaagaagctgcaa
gtggtggtggaccaaggtttagccactctcttcacccctgtttaa

DBGET integrated database retrieval system