KEGG   Cynara cardunculus var. scolymus (artichoke): 112522466Help
Entry
112522466         CDS       T05604                                 

Definition
(RefSeq) putative 1-phosphatidylinositol-3-phosphate 5-kinase FAB1C isoform X1
  KO
K00921  1-phosphatidylinositol-3-phosphate 5-kinase [EC:2.7.1.150]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav00562  Inositol phosphate metabolism
ccav01100  Metabolic pathways
ccav04070  Phosphatidylinositol signaling system
ccav04145  Phagosome
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112522466
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    112522466
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112522466
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccav04131]
    112522466
Enzymes [BR:ccav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.150  1-phosphatidylinositol-3-phosphate 5-kinase
     112522466
Membrane trafficking [BR:ccav04131]
 Endocytosis
  Macropinocytosis
   Kinases
    112522466
 Endosome - Golgi transport
  Others
   Others
    112522466
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIP5K Cpn60_TCP1 FYVE
Motif
Other DBs
NCBI-GeneID: 112522466
NCBI-ProteinID: XP_024987356
Position
LG 12
AA seq 1612 aa AA seqDB search
MGVPDNTLLDLIEKVRSWIYWGRSDLTSMSVEVKMADGVSAMCCQCEMSVSESCLGYHCR
RCSRLFCESCVQGYGSFVVVESKSGTQAGLNIRSCKFCADFDVKQKFGGKFSHKIHPSDS
PRQSPEPPSPNYVHERFDGSSLQAVSVRRSLSSFSGDCRSDEDEAEDSSKNIFSPYSRDT
SDVDSSSVNTRHEFYSFMSVGSSPSDSPSRSHFTSSRRRHSVQLEDQGTPRSLNDGCFDQ
EPVAVLKSHQHGTEEPDNTTNDDLSIFRDQYETSHKPLDLEKNGLIWFPLPPDDEETSFF
SYADDDDDDEMGATSAVFSSSDPLMSLLPENGKNMEHKKPLENVVQGHFRALVSQLLQSE
FTAADEWLDIITSLAWQAANYVKPDTSRGGSMDPGDYVKIKCIASGSPNESTFVKGVVCT
KNIKHKRMTSQYKNPRLLILGGALEYQRSHNQLASIEALLQQEMDHLKTIVSRIEARRPN
VLLVEKSVSSYAQEYLLAKEISLVSNVKRSLLERIARCTGTPITPSVDKISTTRLGQCEL
FRLEKFSEVHEAANLSTKKPSKTLMFFDGCPRRLGCTVLLKGSCREELKKVKHVVQYAVF
AAYHLSLETSFLADEGASLPKTTVKPNIAVPERSNADNAISAISSSTVLSPSEVANSPRF
EGHDLVVDHQNSDLMTDGGVHTVSDPLDGGGALECSRLNVEEIISIESTELEKVERLEVI
DGSNEYYSATDNNQSILVSFSSRCVLNGTVCERSRLLRIKFYGCFDKPLGRYLQDDLFDQ
GWVVMQASLCRSCNEAAEAHVICYTHQQGNLTINVRRLPSLKLPGEKDGKIWMWHRCLRC
AHVDGVPPATHRVVMSEAAWGLSFGKFLELSFSNHATANRIAGCGHSLQRDCLRFYGLGS
MVVFFRYSPIDILSVRLPPSVLQFSGHAQQDWLKKDVSELLSKTEGLYDEILDVLHRTEQ
KSISDGDGILDSGELSKHVKELKEMLIKERNVYTDLLQPCGEESVEDHRDEIDVFELNRL
RHSLMIGLHVWDRRVSSLNSIYNSKPTYDAGSKVEVKHRRCFSTFEHTVDHGRAADDSEP
NQIEETDGSPRDFEESESISSDQFEEGHISAASFLSDKIDSAWAGPLRVASHNSPTDGHE
SSLSRQRNQSHNPHFRRLTSTPARVYSFDSAITLQERFTKELPFLTLRSFQDPNCNIHRS
YSQNFPSEDPKSEFLRGTKPLFISATSFLPEGARLMLPYGGQNAVIAVYDNEPTSIISYA
LASKEYEEWFADKPHLNRNHSVASKLSAWQSFGSVDLDYMQYGNYGSEDPSTAVSLFTDA
KSSHHLTIPFEDESGPGGKVKFSVTCYFAKQFDALRKKCCPSEVDYMRSLSRCKRWSAQG
GKSNVYFAKSLDERFIIKQVTKTELESFEEFAPQYFKYLTDSLNSGSPTCLAKIVGIYQV
TVKHLKGGKEAKMHVMVMENLFYKRNICRVYDLKGSARSRYNSDMTGTNKTLLDMNLLEA
LRTKPIFLGSKAKRSLERAVWNDTSFLASIDVMDYSLLVGVDEESKELVLGIIDFMRQYT
WDKQLETWVKASGILGGPKNASPTIISPKQYKRRFRKAMTSYFLTVPDQWSS
NT seq 4839 nt NT seq  +upstreamnt  +downstreamnt
atgggagtacctgataacacactactagatttgattgaaaaggttagatcttggatttat
tggggaagaagtgatctaacttctatgtctgttgaagtcaaaatggctgatggtgtttct
gctatgtgttgccaatgcgaaatgagtgtctccgagtcttgcctcggttaccactgccga
agatgtagccgattgttttgcgaaagttgtgtgcagggatatggttcttttgttgttgtt
gaatccaaaagtggcacacaagctgggctcaacatccgatcttgcaaattttgtgctgat
tttgatgttaaacaaaaatttgggggaaagtttagtcataagatacatccttctgattca
cctcgacaaagcccggaaccaccttcaccaaattatgtccatgaaagatttgatggttcc
tctcttcaagcagtatccgttcgccgctccctgagcagtttttctggtgactgtaggagt
gatgaagacgaggcagaggattcttcaaaaaacatcttcagcccgtatagtcgtgatacc
tcagatgtagattccagtagtgtgaatacccgacatgaattttacagtttcatgtctgtt
ggttcaagtccttcggacagcccctctaggagtcactttacttccagtagacgtagacat
tctgtacagctcgaagatcagggaactcctaggtcgctaaatgatggttgctttgaccaa
gaacctgtggctgttttaaaaagccaccaacatgggaccgaggaacctgataataccact
aatgatgatttgtcaatatttagggaccaatacgagacttcacacaagccattagatctt
gaaaagaatggtcttatttggtttcctctgccaccagatgatgaagaaaccagtttcttt
tcatatgccgatgatgacgatgatgatgaaatgggagcaacgagtgctgttttctcgtct
agtgatccacttatgagccttcttcctgaaaatggcaaaaacatggaacacaagaagcca
ttggaaaatgtagttcagggtcattttagagctctcgtgtcgcagttattacaatcggag
ttcacagcagcagatgagtggcttgacataataacatcgttagcatggcaagcagcaaac
tatgtgaaaccagataccagcagaggcggcagcatggaccctggtgattatgtaaagatt
aaatgtatagcatcaggaagtcctaatgaaagcacatttgttaaaggtgtagtttgtaca
aaaaatataaagcataaacgcatgacttcacagtacaagaaccctcggttgcttatttta
ggaggagcactcgagtatcagaggtctcacaatcagcttgcttctattgaggccctacta
cagcaggaaatggatcatctgaagacgattgtttcaagaatagaggcccgtcgtccgaat
gtgttactggtagaaaagagtgtatcttcatatgcacaagagtatcttttggccaaggag
atctcattggtttcgaatgtcaaacggtctttattggagcgtatagcaaggtgcaccggc
actccgataactccatctgtcgataagatctctaccacaagactaggccaatgtgagcta
ttccgtttggaaaagttctctgaagtgcatgaagctgccaatctgtccaccaagaagcca
tccaagaccttgatgtttttcgatggttgccccaggcggttgggttgcacggtcttgcta
aaaggttcgtgtcgcgaagaattgaagaaagtcaaacatgttgttcagtatgctgtgttt
gccgcttatcatttgtccctggaaacttctttcctggccgatgagggtgctagtttacct
aaaacaacggtaaagcccaacatagcagtgcccgaaaggtcgaatgctgataatgctata
tccgctatttctagttctacagttctctcgccatcagaagttgccaactccccgagattc
gagggacatgatttagttgttgaccatcaaaactccgatctgatgacggatggaggtgtc
catacggtctctgatccattagatggtggcggagctttagagtgctcaagacttaacgtg
gaagaaatcatatcaattgaatcaacggagctggaaaaggttgaaagacttgaagtgatc
gatggttcaaatgaatactattcagcaaccgataacaatcagagcatattagtatcattt
tctagccgctgtgtattgaatggtaccgtatgtgaacgatcgagactcttgcgtataaaa
ttctatggctgcttcgataagccacttggaaggtacctccaagatgatctttttgatcag
ggatgggttgttatgcaggcatcattgtgtcgatcgtgtaacgaagcagctgaagcccat
gtcatatgctatacacaccagcagggaaacctaacgatcaatgttagacgacttccatct
ctgaagctacctggggagaaagacggaaagatatggatgtggcatcggtgtctcagatgt
gcccatgtagatggggtgccaccagcaactcacagagtggtcatgtctgaggctgcctgg
gggctttcttttgggaagtttttggaacttagtttttcaaaccatgcaacggctaaccgc
attgctggctgtggtcattctctgcaaagagactgcctacgtttctatggtttgggcagt
atggttgtatttttccgctactctccaatcgatattctttctgtccgtttgccgccatct
gtactacagtttagtggccatgctcaacaggattggttaaagaaggacgtatcagagctt
ttgagcaagacagaaggcttgtatgatgagatattagatgtattacatcggaccgaacag
aagagcatctctgatggtgacgggattttagattccggcgagttaagtaagcatgtgaag
gagttaaaagagatgctaattaaagaaagaaatgtttataccgatcttcttcaaccttgc
ggcgaagagtctgttgaggatcatagggacgaaatagacgtatttgaacttaaccgtttg
agacattctctcatgatcggtttgcatgtttgggatcggagggtatcgtccctgaattct
atatataattccaaaccaacatatgatgctggatcaaaagtggaggtcaaacaccggaga
tgtttttcgacttttgaacatactgttgatcatggtcgtgcagccgatgattcagaaccg
aatcaaattgaggaaacggatggatcccctcgtgattttgaggaatctgaatcaatctcg
tctgatcaattcgaagaagggcacatttctgccgcatcgtttctatccgacaagatcgat
tccgcatgggcgggaccgttgagagttgcgtcccataattcaccgacagacgggcacgaa
tcgtctttgtcgagacaaagaaatcaatcccataatccacattttcgaaggctgacttcc
acgcctgctagggtttattccttcgattccgccatcacccttcaagaaagattcacgaaa
gaactgcctttcttgactcttcgatcctttcaggatcccaattgcaacatacaccggagt
tactctcaaaattttcccagtgaagatccgaagtcggaattcttaagggggacgaaaccg
ttgttcatttccgcaacatcttttctccctgaaggtgctcgattgatgcttccttacggt
ggtcaaaacgcagtgattgctgtttatgacaacgagcccacgagcataatatcgtacgcc
cttgcttctaaggagtacgaagaatggtttgccgataaacctcatctcaatagaaatcat
tccgtggcttcaaagctttcagcttggcaatcttttggctctgtcgatctcgattacatg
caatacggtaactatggatcagaagatccttcaacagcagtatcattgtttaccgatgcc
aaaagttctcatcatttaacgattccgtttgaggacgaatcgggacccggtggaaaggtc
aaattctcagtgacatgttattttgcaaagcagtttgatgctctccggaagaaatgttgt
ccgagtgaagtcgattacatgcggtctttgagccgatgcaagagatggagcgcgcaagga
gggaaaagcaacgtgtatttcgcaaaatcgttggatgaacgattcataatcaagcaagtt
acgaaaactgaacttgaatcgttcgaggaattcgcaccgcaatatttcaagtacttgacg
gattcgctcaactcaggaagcccaacttgtcttgctaaaatcgtcggcatttatcaggtt
actgtgaagcatttgaagggtgggaaagaagcgaaaatgcatgtgatggtgatggagaat
ttgttttacaagagaaatatatgtcgggtttacgatttgaaggggtcggcaaggtctcgt
tataactcagatatgacaggaacgaacaaaacactgctcgatatgaacttattggaggct
ttacgaacgaagcccatctttctaggaagcaaagctaagcgaagcctcgaaagagctgtt
tggaatgacacatctttcttagcgtcaattgatgtgatggattactcgttgcttgtcgga
gtggacgaagagagtaaagaattggttctcggaatcatcgatttcatgagacaatacaca
tgggacaaacagctggagacatgggtgaaagcatcaggcattctgggcggacccaagaac
gcttcaccaaccatcatctctccaaaacagtacaagagaaggttccggaaagccatgacc
agttactttcttacggtaccagatcaatggtcatcgtga

DBGET integrated database retrieval system