KEGG   Cynara cardunculus var. scolymus (artichoke): 112523400Help
Entry
112523400         CDS       T05604                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    112523400
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ccav03041]
    112523400
Enzymes [BR:ccav01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     112523400
Spliceosome [BR:ccav03041]
 Complex C
  Other components
   Step II factors
    112523400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C AAA_22 DEAD AAA_30 ABC_tran DUF2075 T2SSE AAA_19 AAA_29 Helicase_RecD DAP3 ATPase_2 AAA_16 FtsK_SpoIIIE Flavi_DEAD
Motif
Other DBs
NCBI-GeneID: 112523400
NCBI-ProteinID: XP_024988759
Position
LG 12
AA seq 695 aa AA seqDB search
MANLPILQFEDKILETVDQNTVAVIIGETGSGKSTQLSQILHRSGYTKAGIIAVTQPRRV
AAVSVSRRVAEELGVRLGDEVGYAIRFEDRTSERTCIKYLTDGVLLRESLSDPELKQYSV
IILDEAHERSLNTDILMGLMKRLIRLRASNLKVLITSATLDGEKVSRFFSDCPILNVPGK
LFPVEILYSSEQPKSYIDSSLRKAIDIHVNEPEGDILIFMTGQDDIEKLVSKLEEKIRNL
EAGSCMDAIVLPLHGSLPPEMQVRVFSPPPRNCRRFIVATNIAETSLTVDGVVYVIDSGY
VKQRQYNPSSGMYSLDVVQISRVQANQRAGRAGRTRPGKCYRLYPSAVYHDDLLDATVPE
IQRSSLAGSVLYLKSLDLPDIDILKFDFLDAPSSETLQDALKQLFLIDAIDENGTITAIG
KTMAELPLEPSLARTLIEANECGCLPQALTIAAMLSVEGTLLPGRSKSTDKKRKHPPSEL
PDGSGWGDHIQLLQIFELWDQTDYSIDWCKDNNLQVRGMLFVKDVRKQLSQIMQKIAKGS
LDVKRKERRRDSQHDYRSLRKALCVGYASQLAERMIHHNGYRTLGFKCQLVQVHPSSVLR
TDDDGMLPNYVVYHELISTSRPYMRNVCEVEMQWVTPILHKLEKLNVSKLSGGSDQSEEK
TTVNSDFPKKVGPIDDSSSRIQAARERFLARKTNK
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacctcccaattctacaatttgaagacaagatattggaaactgtggatcaaaac
acagtggcagtgataattggggagaccggttcagggaagagcactcaactctctcagatt
ttacacagaagtggctacaccaaggccggaataatcgccgtcacgcagcctcgccgtgtt
gccgcggtctctgtttctagaagggttgcagaggagcttggtgtccgactgggtgacgaa
gttggttatgccataagatttgaggataggacttcagagagaacttgtattaagtatctt
actgatggagtacttcttcgtgaaagtctttctgaccctgagctgaaacaatattcagtg
atcatattggatgaagctcatgaaaggagtctaaacactgatatattgatggggctgatg
aagcgtttgattagacttcgcgcctccaatttgaaagttttgatcacttcggctactctt
gatggcgagaaggtgtcaagatttttctctgattgccccatcctgaatgttcctgggaaa
ttgttccctgtagaaatattatatagttcagagcaaccaaaaagttacatcgactcttct
ctgagaaaagctattgacatacacgtcaatgagccagaaggggacattttgatatttatg
actggacaggatgatatagagaagttggtttcgaaattggaggaaaaaattcgaaacctt
gaggcaggatcttgtatggatgccatagtccttccgcttcatggttctttgccacctgaa
atgcaggtgcgagtgtttagtcctcctcctcgaaactgtaggcgttttattgtggctaca
aacattgctgaaacgtctttgactgttgatggtgttgtgtatgttattgactctggttat
gtgaagcagcgacaatataatccatcaagcgggatgtattcccttgatgttgttcagatt
agcagggtgcaagcaaaccaacgagcaggacgagccggacgaacaagacctgggaagtgc
tatcgtctatacccgtctgctgtttaccatgatgatttgctggatgctacagttcctgaa
atacaacggtcttctctagctggcagtgttctttatttgaaatcattggaccttcctgat
attgatattctcaaatttgattttcttgatgcaccttcgtctgaaactttacaagatgct
cttaaacagttgtttctgattgatgctatagatgaaaatggcaccatcacggctattgga
aaaaccatggcagagcttcctttagaaccttcgcttgcaaggaccttaattgaggcaaat
gaatgtggttgtttacctcaagctttgactatagctgctatgttatcagtggaaggtaca
ttgcttcctggacgaagcaaaagcacggacaagaagagaaagcatcctccttcagagctt
cctgatggttccggttggggtgaccacatccagttacttcaaatctttgagctctgggat
caaactgattatagtatcgactggtgcaaagataacaacctacaggtacgagggatgcta
tttgtcaaagatgtccggaaacaattgtctcaaataatgcaaaagattgcaaaagggtcc
ttagatgtaaaaagaaaggaaagacggagagacagccaacatgattataggagtctaaga
aaggctctgtgtgttggctatgcgagccagcttgctgagcgaatgattcatcataatggt
taccgaactcttggcttcaaatgtcagcttgtccaggtgcatccatcttctgtactgcga
acagatgatgacggaatgctcccaaattatgttgtgtatcatgaacttatttctacctca
cgcccatatatgcgcaatgtttgtgaagtagagatgcaatgggttaccccaatactgcat
aaacttgagaagctaaacgtcagtaaactcagtggtggatccgatcagtctgaggagaaa
acaacagttaactcggattttcccaaaaaagtcggcccaattgacgactctagcagtcga
atacaagcagctcgcgagcgttttcttgcccgtaaaacaaacaaatag

DBGET integrated database retrieval system