KEGG   Cynara cardunculus var. scolymus (artichoke): 112524400Help
Entry
112524400         CDS       T05604                                 

Definition
(RefSeq) probable serine/threonine-protein kinase PIX13
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 112524400
NCBI-ProteinID: XP_024989958
Position
LG 13
AA seq 402 aa AA seqDB search
MNTEKQPITAAEGGSDHHGGTATSEKAVVSRGQIVIPKLKMYTFAELQSATKNFRPATIL
GEGGFGQVYKGWVDGVTYAPSKAGVGIPVAVKKSDSDSFQGLKEWQAEVKFLGKFSHPNL
VKLLGYCWENKEFLLVYEYMQKGSLENHLFKKGTETLSWDTRIKIAIGAAHGLAFLHTTE
NKVIYRDFKSSNILLDADFNAKLSDFGLAKLGPINGESHVSTMVMGTYGYAAPEYMITGH
LYVKSDVYSFGVVMLEMITGLRVLDPNRPGSQQNLVDWARPFLADTKKLRRIMDPRMEQV
YPSTCAIKAAGLIRHCLDPNPNNRPSMEEVVASLEEMNAIKMKPKWLKADTKHLMSPHHK
QRLGDRRHVNHHHSPLHTKQGGGARADRSPIQSRDKTTLRVL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaatacggaaaaacaacccatcacggcggcagaaggtggttctgatcatcatggtggc
accgccacttctgaaaaggcagtggtgtctaggggccaaatagtaataccaaagttaaag
atgtacactttcgccgagctacagagcgccaccaagaatttccggccggccaccatcttg
ggagaaggtggttttgggcaggtttataaagggtgggtggatggtgtgacttacgcgccg
tcgaaggccggtgttgggattcccgtcgccgtaaagaaatcagattccgacagctttcaa
ggccttaaagaatggcaggctgaagtgaagttcttggggaaattcagccatccaaatctt
gtaaagttgttgggatattgctgggaaaataaggagtttcttcttgtttatgaatacatg
caaaaaggaagcttagaaaaccatctctttaaaaaaggtacggaaacactctcatgggat
acaagaatcaaaatcgctataggagcagctcacggactcgctttcttgcatacaactgaa
aacaaagtcatttatagggattttaagtcttcaaatattttactagatgcggattttaat
gcaaaactctcggatttcgggttggcgaagttaggtccaatcaatggagagtctcatgtc
tcaacaatggtaatgggcacctacggttatgcagctcctgagtacatgattacgggtcat
ttatacgtcaaaagcgacgtttacagctttggggtagtcatgctagagatgattacagga
ttacgtgtacttgatcctaatcgacctgggtcgcaacagaatttggtggattgggctaga
cctttcttggccgatacaaaaaaattacgaagaatcatggacccacgaatggaacaagtt
tacccttcaacatgtgcaattaaagcagcaggacttatccgacattgtcttgatcctaac
cccaataaccgaccttcaatggaggaagtggttgcaagtttagaagagatgaatgcaatt
aaaatgaaaccgaagtggttaaaggctgacaccaaacacttaatgagcccacaccacaag
caaaggcttggtgaccgtcgtcatgtgaaccatcaccactctccccttcatacaaagcaa
gggggaggagctcgggctgatcgatcacccattcaatcccgtgataaaacaactcttcgt
gttctttga

DBGET integrated database retrieval system