KEGG   Cynara cardunculus var. scolymus (artichoke): 112524452Help
Entry
112524452         CDS       T05604                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: alcohol dehydrogenase 1-like
  KO
K18857  alcohol dehydrogenase class-P [EC:1.1.1.1]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav00010  Glycolysis / Gluconeogenesis
ccav00071  Fatty acid degradation
ccav00350  Tyrosine metabolism
ccav00592  alpha-Linolenic acid metabolism
ccav01100  Metabolic pathways
ccav01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112524452
  09103 Lipid metabolism
   00071 Fatty acid degradation
    112524452
   00592 alpha-Linolenic acid metabolism
    112524452
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    112524452
Enzymes [BR:ccav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     112524452
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 112524452
NCBI-ProteinID: XP_024990040
Position
LG 13
AA seq 379 aa AA seqDB search
MSTNVGQVIRCKAAVAWEAGKPLVIEEVEVAPPQKMEVRIKILFTSLCHTDVYFWEAKGQ
NPVFPRILGHEAGGIVESVGEGVTDLQPGDHVLPVFTGECKECAHCKSEESNMCDLLRIN
TDRGVMIHDQKSRFSIQGKPIFHFVGTSTFSEYTVVHVGCLAKINPLAPLDKVCVLSCGI
STGLGATLNVAKPKKGSSVAIFGLGAVGLAAAEGARIAGASRIIGVDLNANRFELAKKFG
VTEFVNPKDXKKPVQEVIAEMTNGGVDRSVECTGHIDAMISAFECVHDGWGVAVLVGVPH
KDAVFKTNPVNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHEVPFSEIN
KAFDLMXGEGLRCIIRMDA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactaatgttggtcaagtgattcgatgcaaagcggcggtggcgtgggaagctggg
aagccactggtgattgaagaagtggaggtggcgccaccccaaaaaatggaagtccgaata
aagatcctcttcacctccctgtgccacaccgacgtttacttctgggaagccaagggtcag
aatcctgtgtttcctcgaattttaggtcatgaggctggagggattgtggagagtgttggg
gaaggagtgactgatcttcagccaggagaccatgttcttcctgttttcaccggagaatgc
aaagaatgtgctcactgtaagtccgaagagagtaatatgtgcgatctcctgaggatcaac
accgatcggggagtcatgattcatgatcagaagtctcggttttcgatccaaggaaaaccc
attttccatttcgttggaacttcgacctttagcgaatacaccgtggttcatgttggatgt
cttgccaaaatcaaccctcttgctcctctcgacaaagtttgtgtcctcagttgtggaatc
tccacaggcctgggtgctactttgaatgttgcaaaaccgaaaaaaggctcatcggtcgcc
atttttggactcggagctgtgggacttgctgctgctgaaggtgcaagaattgctggtgct
tcaaggatcattggggttgatctcaatgccaatagatttgagcttgcaaagaaattcggg
gtaacggagtttgtgaacccaaaagactwcaagaaaccggtacaagaagtgattgctgag
atgacgaatggaggtgttgacaggagtgttgaatgcaccggccatattgatgctatgatc
tctgcctttgaatgtgttcatgatggttggggagttgctgttcttgtgggtgttccacat
aaagatgccgttttcaagacgaatcctgtgaatctattgaacgaaaggactctgaagggt
accttctttggaaactacaaaccacgatcagaccttccatctgtggtcgaaaagtacatg
aataaggaacttgaggtggagaagttcataacacatgaagtgccattttctgagatcaac
aaggccttcgatttgatgncnggtgaaggtcttcgttgcatcattcgcatggatgcatag

DBGET integrated database retrieval system