KEGG   Cynara cardunculus var. scolymus (artichoke): 112524475Help
Entry
112524475         CDS       T05604                                 

Definition
(RefSeq) histidine kinase 3 isoform X1
  KO
K14489  arabidopsis histidine kinase 2/3/4 (cytokinin receptor) [EC:2.7.13.3]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04075 Plant hormone signal transduction
    112524475
Enzymes [BR:ccav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     112524475
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CHASE HATPase_c Response_reg HisKA COX4
Motif
Other DBs
NCBI-GeneID: 112524475
NCBI-ProteinID: XP_024990068
Position
LG 13
AA seq 1010 aa AA seqDB search
MSFIHLIGFGLKVGQLLLMLCCSFLSVISTNCFTNGVEMKPKSGFIGISTSTRKIWMKFL
EILAGNSSKIHHHYYQYIGSRKVRKTWWRKLLILWVAFGTIVSLWFFWYLRSQAMEKRKE
TLANMCDERARMLQDQFNVSMNHVQAMSILISTFHHGKKPSAIDQETFAKYTERTAFERP
LTSGVAYAVRVLHSEREQFEKQQGWTIKKMTPVNKDEYNPEELEPSPIQQEYAPVIFAQD
TVAHVISLDMMSGKEDRENVLRARALGKGVLTAPLDLIKSNRLGVILTFAVYKRDLPSNA
TLEERIQATDGYLGGVFDIESLVEKLLQQLASKQTIYVNVFDTTNISNPISMYGTNVSDT
GLHHVSPLNFGDPSRKHEMQCRFKQKQPWQILALSTSFGIFVITLLVGHIFHATVNRIAK
VEDDYLEMSELKRRAEAADVAKSQFLANVSHEIRTPMNGVLGMLDMLMDTVLDVTQQDYV
RTAQASGKALVSLINAVLDQAKIESGKLELEAVHFDLRAILDDVLSLFSGKSQEKGLELA
VYISEKVPETLIGDPGRFRQIITNLMGNSIKFTEQGHIFVTVHLVEEVMESIGVETEPSL
KDTLSGLPVADRNRSWDGFRTSSQMVGPCDNITLIVSVEDTGVGIPLEAQSRIFTPFMQV
GPSISRIHGGTGIGLSISKCLVNLMNGEIGFTSIPKVGSTFTFTAVFSNGCSNPSEQQVN
TWSKSEFRGMQAIIVDPRPVRAAVSRYHIQRLGMHVDIVPNLTNTFSMLSNGSKVVHMIL
IEEEVWDKDLSSSAVFVYKLRTVDHKIPWKLFLLANSIGGSRGISCPPVITKPLRVSMLA
ASLQRAMGGNKSTARNGEVPKLSLSKLLVGRKILVVDDNNVNLRVAAGALKKYGAEVVCA
DSGRKAISLLKPPHSFDACFMDIQMPEMDGFEATKTIREMEYNVNNLIQHGKLLLQDYAN
ISNWHVPILAMTADVIQATHEQCLKSGMDGYVSKPFEANQLYQEVSRFFL
NT seq 3033 nt NT seq  +upstreamnt  +downstreamnt
atgagttttatccatctgattggatttggcttaaaagtgggtcagcttcttttgatgcta
tgttgctcgtttctatcagtgatctcgacgaattgcttcactaatggtgtagagatgaag
cctaagagtgggtttattggaatcagtactagtactcggaagatttggatgaaatttctc
gagatcttggcagggaacagctccaagatccatcatcactactatcaatatattggttca
agaaaagttagaaagacatggtggaggaagcttttgatcttatgggttgcatttggtaca
attgtttctttgtggttcttttggtatttgagatctcaagccatggagaagaggaaagaa
acactagcaaacatgtgtgatgaaagagctaggatgcttcaagatcagttcaatgtcagc
atgaatcatgttcaagctatgtctattttgatctcaactttccaccatggcaaaaaacct
tcagcaattgatcaggagacctttgctaagtatacagaaagaactgcttttgagaggcca
cttacaagtggggtggcttatgctgtaagggtacttcattcagaaagagaacagtttgag
aagcaacaaggatggaccataaagaagatgaccccagttaataaagatgagtataatcct
gaagaattggagccatccccaattcaacaagaatatgcccctgttatctttgcacaagat
accgttgctcatgtaatttcgcttgatatgatgtcaggaaaggaagatcgtgaaaatgtg
ttgcgagctagggcattaggaaaaggggttctgaccgcccctttggatcttataaagtca
aaccggcttggagtcatattgacatttgctgtttataagcgagatcttccctcaaacgcc
actctagaggaaaggatccaggcaactgatggttaccttggtggagtatttgatatcgaa
tcattggtggaaaagttacttcagcagcttgcaagcaaacaaaccatctatgtgaatgtc
tttgacacgactaatatatcaaatccgatcagtatgtatggtactaatgtctcagacacc
ggtttgcaccatgttagtcctctcaattttggcgatccctcaagaaagcacgagatgcag
tgcagattcaaacaaaaacaaccgtggcaaatcttagcgctatcaacttcttttggtatc
tttgtgattaccttgcttgttgggcatatctttcatgcaactgtaaatagaatagccaaa
gttgaagatgactatcttgaaatgtcagagctcaaaagacgcgcagaggctgctgatgtg
gccaaatctcagttcctcgctaatgtttcccatgaaatcagaaccccaatgaatggtgtt
cttgggatgctggatatgcttatggacactgttcttgatgtaacacaacaagattatgtt
agaacagctcaagctagtggaaaagctctagtttcacttataaatgcggttcttgatcaa
gccaaaattgaatctggtaagctcgagctcgaagccgtccacttcgatcttcgggctata
ctagatgacgtattgtcactattttcagggaagtcgcaagaaaagggacttgagttggca
gtttacatatctgagaaagtcccagaaacgctgattggtgatccagggcgatttcgtcaa
atcatcacaaacctcatgggtaactctattaagttcacggagcaagggcacatctttgta
acagtgcatcttgttgaggaagtaatggagtcgataggtgtagagactgaaccatcattg
aaagacacattaagtggactgcctgtggctgatagaaaccgcagctgggatgggttcaga
acctcgagtcaaatggtgggtccatgtgataatattactttgattgtatccgtcgaggat
acgggtgttggaatcccgctagaagcacaatctcgtatctttactccgtttatgcaagtg
ggtccctccatttcccgtatacatggaggaactggtattggtctaagcatcagcaagtgt
ttggtgaacctaatgaatggcgagattgggttcactagcatcccaaaagttgggtccact
tttacgttcactgctgttttcagcaatggctgttcgaatccaagtgagcagcaagtcaac
acttggtcaaagtcggagtttcgtggcatgcaagcgatcatcgtggatcccaggcccgta
cgagctgcggtatcaagatatcacatccaacggctaggaatgcacgtggacattgtgcca
aatttgaccaacacattctctatgttgagcaatggaagtaaagtggtccacatgatcctg
attgaagaggaagtttgggataaagatttaagctcgtcggcggtgtttgtttataagtta
agaacagtagatcacaagattccttggaagctgtttcttttagcgaattcgattggtggg
tctcgtggcatttcttgcccacccgtcataactaaaccgttaagggtcagcatgttggct
gcatctttacaacgagcgatgggtggtaataaaagtaccgcccgaaatggagaggtcccg
aaactatctttgtcaaagctgttggtgggaaggaaaatactggtggtggacgacaataat
gtgaacctacgagtggctgcgggtgcgttgaagaaatatggagcggaagtggtgtgtgcg
gatagcgggaggaaagctatttccctgctaaagccgcctcactcttttgatgcgtgtttc
atggatatccagatgcccgaaatggatgggtttgaagcaacaaaaacgattcgtgagatg
gaatacaatgtgaataatcttatccaacacgggaaactattattgcaagactatgcgaat
atttcaaactggcatgttccaatcttggccatgactgctgatgttattcaagctacacat
gaacaatgcctaaaatctggaatggatggctatgtctctaaaccatttgaagcaaatcaa
ctttatcaagaagtttcaagatttttcctatga

DBGET integrated database retrieval system