KEGG   Cynara cardunculus var. scolymus (artichoke): 112524542Help
Entry
112524542         CDS       T05604                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav00010  Glycolysis / Gluconeogenesis
ccav00562  Inositol phosphate metabolism
ccav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112524542
   00562 Inositol phosphate metabolism
    112524542
Enzymes [BR:ccav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     112524542
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     112524542
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 112524542
NCBI-ProteinID: XP_024990169
Position
LG 13
AA seq 496 aa AA seqDB search
MAKPVTIGFMLLVLYCVQFSSTAEETFDVRQHLSTVTRYEASKHIKDNAFVSSNIPDKCS
PIHLNLVARHGTRAPTKKRMKDLETLSTRLKDIMQSAKERGSSLEKLPSWLREWSSPWKG
KIKGGELISLGEDEMYHLGSRVRERFQELFSDEYHPDVYLIRATQIPRASASAVAFGMGM
FSGRGNLGPGRHRAFAVLSESRASDIMLRFHDCCQNYKAFRKNQEPSVHKLKEPVLDEIT
RSLAARYELNLTIKDTSTLWFLCKQEASLLNVTNQACDLFSNDEVKLLEWTDDLEMFILK
GYGNSLNYRMGVPLLEDVILSMEQAITAKEEGHAPGSYEKARLRFAHAETLVPFSCLIGL
FLEGSEFDQIQREEPLKFPPKPPQKRTWRGSTVAPFGGNNVLVLYSCSANNTSKFFVQVL
HNEKPIPMAGCGATDFCPFEVFKEKIGAAHLKHSYDHLCNAKLQQQSKPFMSKLIEIFSW
IFTGKSNDNESQKTEL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaccggtgacgataggtttcatgctactggttttgtattgtgttcaatttagt
tcaaccgctgaagaaacgtttgacgttcgtcaacacctgtccaccgtaacaagatacgag
gcctcaaaacacatcaaagataatgcgtttgtttcttcaaacattcctgataaatgttct
cctatccacctaaatctcgtggcaagacatggaacacgtgcacctactaagaaaaggatg
aaagacttggaaactttgtcaacaagacttaaagatattatgcaaagcgcaaaagaaaga
gggtcttctttggagaaacttccttcctggttacgggaatggagttctccatggaagggg
aaaatcaaaggtggtgaactaataagcctaggagaagatgaaatgtatcatcttggaagc
agagtcagggaacggttccaggaactgtttagtgatgaatatcacccggacgtatatctg
ataagggcaactcagattccgcgggcatcagctagtgctgtggcatttggaatgggcatg
tttagtggcagaggaaatcttggaccaggaaggcatcgagcttttgcagttctgagtgaa
agccgcgcaagtgatataatgttgagatttcatgattgttgtcagaactacaaggctttt
agaaaaaatcaggaaccttctgttcataagcttaaagaacctgtattagatgaaattacc
cgttcattagcagcgcgttatgagcttaatctcacaataaaggatacttccacactttgg
tttttgtgcaagcaggaagcatccttgttgaatgtaactaatcaggcttgtgatcttttc
agtaatgatgaggtaaaattattagagtggacagatgacctggagatgttcatattaaag
ggttacggtaattcactaaattatcgaatgggagttccattgctggaggatgtcattttg
tccatggagcaggccattacagcaaaagaagaaggacatgcacctgggagttatgaaaag
gcaaggttacggtttgctcatgcagagacgttggtccctttttcatgtttgattggactc
tttcttgaaggatctgagtttgaccaaattcaaagagaagagcccttgaaattcccccca
aaacctccccagaaaagaacttggaggggcagcacggtggcaccttttggtgggaataat
gttttagttttatacagctgttcagcaaataacacgagcaaattctttgtgcaagtacta
cacaatgaaaaaccgatcccaatggctggatgtggggctactgatttctgtccctttgaa
gtttttaaggaaaaaataggtgctgcacacttgaagcacagctacgatcacctatgcaat
gccaaattgcaacagcaaagcaagccatttatgagtaagttaattgaaatatttagttgg
attttcactggaaagagcaacgataacgaatcccagaaaacagagctttag

DBGET integrated database retrieval system