KEGG   Cynara cardunculus var. scolymus (artichoke): 112525682Help
Entry
112525682         CDS       T05604                                 

Definition
(RefSeq) methyltransferase-like protein 1
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ccav03019]
    112525682
Enzymes [BR:ccav01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     112525682
Messenger RNA biogenesis [BR:ccav03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     112525682
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70 ANAPC_CDC26
Motif
Other DBs
NCBI-GeneID: 112525682
NCBI-ProteinID: XP_024991673
Position
LG 13
AA seq 1171 aa AA seqDB search
MGSPERVKGSVKKDIEDSSGARSDRARDDETWEVDERRKRRSGKSRQSGSGEEAEGLENN
GRKRSGEEKSESRKRPGGSSKAVSEDDDYESRKESRAKQLKKKQEESALETLSNWYQDGE
GENRHDGGERSERRKSASKLSDRESSQSRSKGRDERLHDGELEKLQDKDLRHSERKEISR
EKGHGSSDSGRHPRKRWDDANVVSKVEENTHGEKSDQRIGKSSDMKHEGSMERSLPGYSE
ANESRSRGIDVSGDKGVKYHEKDEGRGEIEKIKSKGDLEVHEEDNEENPSSHEDMAVKEK
IDDHKQQRSLTGHDAVESRERSYNADEDGSTWIRDRGRRDNDRSTRSRTPERIARRHHET
EYSELDSDKSSSYRRKDLEKDGYREERSKGRDDCWGDKNRDREGLKDNWKRRQSNFPDKE
MKDGDAPYDFTRDWESPSQRRGRDRADTERHMGRAGGRKDGNRTDAVKTSSNYGISKDNY
DVIEIETKPFNYGREDSRSSFGRKNEVNEQSDIKPGPNDEYGYPRDDNIARNADDQSVED
SKDKYGDDRNMDDIEGGKGRGQRGSLPNRAGGWQGPSSSSDSQPSHGYQDPGSFNRGVSQ
GVKGNNRMGRGGRVRPTGRDGQQVNLQVPMMGSPFGPLGMPPPGGLQPLTPSMSPGPGPP
MSPAVFIPPFSPPVVWPGVPPGLSGVPPGGPSGPRFPPNIGTPPNSAMYFNQPGPARGMP
PNIPGTGFNALGPMGRGQQQDKGPGGWVPPRNNGPPGKAPSRGEQNDYSQNFVDTGMRPQ
NFIRELELTSVVEDYPKLRELIQKKDEIVANSASAPMYYKCDLREQVLSPEFFGTKFDVI
LVDPPWEEYVHRAPGVTDHMEYWTFEEIMNLKIEAIADTPSFVFLWVGDGVGLEQGRQCL
KKWGFRRCEDICWVKTNKTTATPGLRHDSHTLFQRSKEHCLMGIKGTVRRSTDGHIIHAN
IDTDVIIAEEPPYGSTAKPEDMYRIIEHFSLGRRRLELFGEDHNIRSGWLTVGKDLSSSN
FNSEGYVRNFADKDGKVWQGGGGRNPPPEAGHLVLTTADIEALRPKSPMKNQLQMQQQQQ
QSNSISLTAGGGSNKRPTGNSPSNHNGPGGMNQEASGSNISGPVPWGPPMGGGMGPDERY
FENMYGYNGPFGPMGGDYMDFETHRAMNNML
NT seq 3516 nt NT seq  +upstreamnt  +downstreamnt
atgggttcacccgaacgtgtaaaaggttctgtgaaaaaggacatagaagatagttcaggt
gcaaggagtgatagggccagagacgatgaaacatgggaagtggatgagaggagaaagcgg
aggtcgggcaagtcaaggcaatcagggagtggagaggaagctgaaggattggaaaataat
ggaagaaagagaagtggtgaggagaaaagcgagagtaggaagaggccaggtggctcgagt
aaggcagttagtgaggatgatgattatgagtcacgaaaggagtcacgagctaagcaattg
aagaagaaacaagaagagagtgctttggagacattgagcaattggtatcaggatggagag
ggagagaacagacatgatggtggagaaagaagtgagagaagaaaatcggcttcaaaactg
tctgatcgtgagagttcccaaagcagaagtaagggtagagatgaaagattgcatgatgga
gagcttgaaaagcttcaggacaaggatttaagacactctgagagaaaggaaataagccga
gaaaagggtcatgggtcttctgattcgggacgacatccaagaaaaaggtgggatgatgca
aatgttgttagcaaggtagaagaaaatacccatggggaaaaatctgatcaaaggattgga
aagtcttcagatatgaagcacgagggttctatggaacgaagtttgcctggctatagtgaa
gcaaatgagagtagaagcaggggtattgatgtgagtggtgataaaggtgttaaataccat
gaaaaggatgagggaagaggtgaaattgagaagattaagagtaagggagatttagaagtt
catgaagaagacaatgaagaaaatccctcaagtcatgaagatatggcagtcaaggagaaa
attgatgatcacaagcagcagagaagtctaactggacatgatgctgttgaaagccgtgag
agatcctataatgctgatgaagatggtagtacatggataagggataggggtagaagagac
aatgaccgttctaccaggtccaggacccctgagagaattgcaaggcgtcatcatgagaca
gaatacagtgagttggattcagataaaagcagcagttacagaaggaaagacctggaaaaa
gatggttatagagaggaaagatcgaaaggaagagatgattgctggggtgacaagaacagg
gaccgtgaaggcttgaaagataactggaaaagaaggcaatccaactttcctgacaaggaa
atgaaagacggtgatgccccttatgacttcacccgagactgggagtcaccatcacaaaga
cgtggtcgtgatagggctgacactgaaaggcatatgggtcgtgctggtggcagaaaggat
gggaacaggactgatgctgtgaaaacctcatcaaattatggtatttcaaaagacaattat
gatgtgatagagattgaaaccaaacctttcaattatggaagggaggattctagatcttca
tttgggaggaaaaatgaagttaatgagcagtctgatataaaaccaggaccaaatgatgag
tacggttatccacgtgacgacaatattgcaagaaatgctgatgatcaatctgttgaagat
tcgaaagataaatatggagatgacagaaacatggatgacattgagggagggaaaggtaga
ggccagcgtggtagcttgcccaatcgtgctggtggctggcaaggaccatcttccagtagt
gattcacagccgtctcatggataccaagatccaggttcctttaacagaggtgtttctcaa
ggtgttaaaggtaacaacagaatgggaagaggaggaagggttcggcctacagggagagat
ggtcaacaagtcaatttgcaagtgccaatgatgggttcaccttttggaccactcggaatg
ccaccacctggtggattgcaaccacttacacctagcatgtctcctggtccaggtcctccg
atgtctcctgctgtctttatcccaccattttctcctcctgttgtttggccaggagttcca
cccggtctttcaggtgttcctcctggtgggccatcgggacctagatttcctccaaatata
gggaccccacccaattctgctatgtattttaaccaacccggacctgcaagaggaatgcct
ccaaacatccctggtactggttttaatgctctaggaccaatgggccgcgggcagcaacaa
gataagggaccaggtggatgggttcctcccagaaataatgggcctcctggtaaagctccc
tctagaggagaacaaaatgattattcccagaattttgttgacactggtatgcgaccccag
aactttatcagggaactagagctcactagtgttgtggaggactatccaaagcttcgggag
cttatacaaaagaaggacgaaattgttgctaactctgcttctgctcctatgtattacaag
tgtgacctgcgcgagcaagtcttatctcccgagttctttgggaccaagttcgatgttatt
cttgtggaccctccttgggaggaatatgttcatcgagctcctggggtcactgaccatatg
gagtactggacatttgaggaaataatgaatctcaagattgaggcaatagccgacacacca
tcttttgttttcctctgggttggtgatggagttggtcttgagcagggccggcaatgtcta
aagaagtggggattccgtaggtgtgaagatatatgttgggtgaaaacaaacaaaaccact
gcaacacctggattgcgtcatgattcacatactttattccagcgctcaaaggagcactgc
ttgatgggcataaaaggaacggtacgtcgcagcactgatggtcacataatccatgccaac
attgacacagatgtaatcatcgccgaggagcctccatatggttctactgcaaaacctgaa
gatatgtaccggataattgagcatttctcgctcggtcgccgtagacttgagcttttcggc
gaagatcataatatacggtctggctggttgactgttggtaaagatttatcctcgtcaaat
ttcaattccgaggggtatgttcgaaattttgcggataaggatgggaaggtgtggcaagga
ggaggaggaagaaacccgccaccagaagccggtcatcttgtccttacgactgcggacatc
gaagctctcaggccgaagtcaccaatgaagaaccaactccaaatgcagcaacagcagcaa
cagtcaaattccatatccctgacagcaggtggtggaagcaacaagaggccaactggcaac
tcaccatcgaaccataatggaccaggaggcatgaaccaagaagcatcgggctctaatatc
tccggtcctgttccgtggggtcctccgatgggtgggggtatgggtccggatgagaggtat
ttcgaaaatatgtatgggtataatggtccttttggacccatgggtggtgactacatggat
tttgaaacacatagagccatgaacaatatgttgtag

DBGET integrated database retrieval system