KEGG   Cynara cardunculus var. scolymus (artichoke): 112527453Help
Entry
112527453         CDS       T05604                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit alpha-2, mitochondrial isoform X1
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav00020  Citrate cycle (TCA cycle)
ccav00640  Propanoate metabolism
ccav01100  Metabolic pathways
ccav01110  Biosynthesis of secondary metabolites
ccav01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    112527453
   00640 Propanoate metabolism
    112527453
Enzymes [BR:ccav01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     112527453
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     112527453
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 112527453
NCBI-ProteinID: XP_024993890
Position
LG 15
AA seq 338 aa AA seqDB search
MSRQATRFIANLSSKLTSGTSASSSSSNSIYQSRSFATAPPPPAVFVDKNTRVICQGITG
KNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFA
AAAIMEAMDAELDLVVCITEGIPQHDMVRVKSALKQQSKTRLIGPNCPGIIKPGECKIGI
MPGYIHKPGRIGIVSRSGTLTYEAVYQTTAVGLGQSTCVGIGGDPFNGTNFVDCMTKFIA
DPQTEGIILIGEIGGTAEEDAAALIKESGTDKPIVAFIAGLTAPPGRRMGHAGAIVSGGK
GTAQDKIRTLREAGVTVVESPAKIGAAMLEVFKQRGLV
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgacaagccactcgattcatcgcaaacctctcctcaaaactcacatctggtacg
tcagcatcatcatcgtcttcgaattcgatttatcaatcgcgttctttcgccacagctcct
ccacctccggcagtcttcgtcgacaagaacacccgcgtcatttgtcaaggaatcactgga
aaaaatggcacctttcataccgagcaagccattgaatacggaactaagatggttggtgga
gttaccccaaagaagggtggaacagagcatttggggctccctgttttcaacacagtcgca
gatgcaaaagctgaaaccaaggctaatgcttctgtaatatatgtaccaccaccgtttgct
gcagcagcaatcatggaggcaatggacgctgaactggatttagttgtttgcattacagaa
ggaataccacaacatgacatggttcgtgtgaagtctgctcttaagcagcagtcaaaaact
cggttaattggtcccaactgccctggtatcattaagccaggcgaatgcaagattggcatt
atgcctgggtacattcacaaaccaggacgcattggtattgtatctcgatctggcacgcta
acttatgaagcggtttaccaaaccactgctgttggcctaggccaatccacctgtgtaggc
atcggtggggatccttttaacgggaccaactttgttgactgcatgacaaaattcattgct
gatccccagacagaaggtatcattctgattggtgagattggtggtactgcagaagaagat
gctgctgccctcataaaggaaagtgggactgataagcctattgttgcctttattgctgga
cttactgctccacctggtcgacgtatgggtcatgctggagccatagtatcaggcggaaag
ggtacggctcaagacaaaatccggaccctgagggaagctggtgtgacggttgttgaatca
ccagcaaagatcggagctgctatgcttgaagtcttcaaacagaggggtcttgtatga

DBGET integrated database retrieval system