KEGG   Cynara cardunculus var. scolymus (artichoke): 112528101Help
Entry
112528101         CDS       T05604                                 

Definition
(RefSeq) probable carotenoid cleavage dioxygenase 4, chloroplastic
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Pathway
ccav00906  Carotenoid biosynthesis
ccav01100  Metabolic pathways
ccav01110  Biosynthesis of secondary metabolites
Module
ccav_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    112528101
Enzymes [BR:ccav01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     112528101
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 112528101
NCBI-ProteinID: XP_024994794
Position
LG 1
AA seq 546 aa AA seqDB search
ATQPNPSVEVIRDSRKPSSEPDLLEKVFRTLDDAIIKFLDPPLDISVDPSYVLGDNFAPV
DELGPTECEVVHGSIPPCLDGVYIRNGPNPQFVPSGPHHYFDGDGMVHSIRISHGRATFC
SRYVKTNKYLFEHQIRSNVVPNVIGGMHGLGPFMARATLFAARVISGRYDIVKGIGVANT
SLSLFGGRLYALCESDIPYAIKLEEDGDIRTLGHHDFDGKLTMNMTAHPKIDPETKEAFA
FRYWATQPYLTYFNFDSNGNKQPDVPIFSMKHSSLTHDLAITQKYAVICEIQIGANPMNL
IRGGRLVDVDPRKVPRIGVLPRYAKDDSDMKWFEVPGFNIFHSVNAWDEKDEDGGDVVVL
VAPNILSVEHFFKRADLIHGSMEKVTIHLETGVVSRHRLSTRSSEFPVINPAYVAKKNKY
VYVAVSEEIPLKSKIMRASGVAKLDISASEDNNGGHDCTVGSRMYGDNCFGGEPFFVARE
PDNRESEEDDGYVVSYVHNESSGESSFLVMDARSPDLQVLAAVKLPQRVPYGLHGIFIRE
KDLNEI
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
gcaacccaacccaacccatctgttgaagttatacgggattcaagaaaaccatcatcggag
ccggatttactcgaaaaagtgttcaggacactcgatgatgctataatcaagtttcttgat
cctcctcttgatatatcggttgacccgagctatgtcttaggtgataatttcgcaccggtt
gatgagttgggtccaaccgagtgcgaggtggtgcatggctccatccctccatgcctcgat
ggtgtgtacatccgtaacggacccaacccacagttcgtcccaagtggtccgcaccattac
tttgatggggatggaatggtacactccattaggatctctcacggtcgtgccactttctgc
agtcgttacgtgaagaccaacaagtacctcttcgaacaccaaattagatcaaatgtcgtt
ccgaatgtcatcggtggcatgcatggtctaggcccgttcatggctcgtgcaacgttgttc
gctgcacgagtcatttccgggcgttacgatatcgtcaaaggcattggcgtagccaacacc
agtttatcgttgttcggtggccgtttatacgctttatgtgagtccgatatcccgtatgcg
atcaagctcgaagaagatggcgacataagaacgttgggtcaccatgattttgatggcaag
cttacgatgaacatgaccgcgcacccgaagatcgatcccgagacgaaagaggccttcgcg
tttcgttactgggcgacacaaccttacctgacttacttcaacttcgattcaaacggaaat
aagcagccggacgtccccattttctccatgaaacactcgtctctaactcatgatttggcc
atcacccagaagtatgcagtcatctgtgagattcaaatcggtgcgaaccccatgaacctg
atccgtggaggacggttggtcgacgtagaccccagaaaggttccaagaattggcgtacta
ccacgatatgcgaaggatgattccgatatgaagtggtttgaagtccctgggttcaatata
tttcattcggtcaatgcatgggatgagaaggatgaagacggtggcgacgtggtggtgctg
gtggcacccaatatcttgtcggtggaacacttttttaagcgagcagatctcatccatgga
tccatggagaaagtgacgattcacttggagacaggggttgtatccaggcaccgtttgtcg
actagaagttcggagtttccggtgattaatccggcctatgtagcgaaaaagaacaagtat
gtgtacgtagcagtttctgaagaaattccattaaagtcgaagataatgagggcatcaggg
gtggcaaagcttgacatatctgcttcagaagacaacaatggcggacatgactgcacagtg
ggtagtcggatgtatggagataactgcttcggaggcgagccatttttcgttgcaagagag
ccggacaatcgagagtcggaagaggacgacgggtatgtggtgtcgtatgtgcataatgaa
agctcaggcgagtcgagtttcttggtgatggatgcccggtcaccggatcttcaagtgttg
gcggcggtgaagctgccgcaaagagtgccgtacggtttacatgggatattcattagggaa
aaggatctcaatgaaatctga

DBGET integrated database retrieval system