KEGG   Cynara cardunculus var. scolymus (artichoke): 112529107Help
Entry
112529107         CDS       T05604                                 

Definition
(RefSeq) beta-glucosidase 24-like
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-GeneID: 112529107
NCBI-ProteinID: XP_024995949
Position
LG 16
AA seq 545 aa AA seqDB search
MAEATMQEFDQAHHXBDEIKRQNFPSNFLFGVGTSAYQVEGAWNADGKGLSIWDSFTLRN
PDKIAGGANACVTVDSYSRMKEDVQLLKKMGLNSFRFSISWSRILPGGKVSMGKNQEGIN
YYNKLIDKLLANGIEPFVTIFHWDLPNALEEEYMGFLSSMVVADFVDYADICFWEFGDRV
KNWXTLNEPHXFTXXGYITGXXAPGRGEKSKDNDLEIEPYTVAYNLLNCHAAAYRKYEKD
YKGFQKGKVGITLDLLFFKPYRGPSNRQDVKAVEYAFDFVNGWFLEPLVKGTWPENMQKF
ATTPTAKYPNGRTLPKFSDDQRTKLIDSYDFLGINYYTANYAQYQAPSSDIPLGYATDCH
FKATGNDPNDIPIGKPAYPDSWVYLCANELTELLYRVKSTYNVSKPIIITENGSPDKTDL
GKTYQEVRDDTYRMEYIEKHLIAIRTAMRNNVNIMGYFVWSFMDSFEWESGYDIRFGMMY
VDYANNLQRYPKNSAIWFKKFLSETKGGFLKRTLMDGEEEDEVNNVVSEAEKATEVIPKL
KKVKA
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcaacaatgcaagagtttgaccaagctcaccacttkratgatgagattaaa
cgtcaaaactttccaagtaatttcttgtttggagtaggcacatctgcttatcaggttgaa
ggtgcatggaatgcagatggtaaaggcttgagtatctgggattcttttacactaagaaay
cctgacaagatcgccggaggtgcaaatgcatgtgtcacagttgatagctactcaagaatg
aaggaagatgttcagttgttgaagaaaatgggtctgaactctttcagattctctatttca
tggtcaaggatattaccaggtgggaaagtgagcatgggtaaaaaccaggaaggcattaat
tactacaacaaattgattgacaagttactagccaatggcattgagccatttgtcacaatt
tttcactgggatcttcccaacgctttggaagaagaatacatgggtttcttaagttcaatg
gtcgtggctgattttgttgattatgccgatatttgcttttgggagtttggagatcgggta
aagaattggtygactctaaacgagccacataygttcacawatarmgggtacataacaggt
ayatwtgcacctggacggggtgaaaaaagtaaagataacgatcttgaaatagagccatat
acagttgcatacaacctactcaactgccatgcagctgcttatagaaagtatgagaaagat
tataagggttttcaaaagggtaaagtaggaattacccttgaccttctatttttcaagcct
tatcgtggcccgagtaatcgacaagatgtcaaagccgtcgaatacgcatttgattttgta
aatggatggtttcttgagccattagtgaaaggaacatggccggaaaatatgcaaaagttt
gccactactccaactgctaaatacccgaatggtcgtactttgcctaaattctcggatgat
caacgcaccaagttgattgactcatacgattttctaggaataaactactacactgcgaat
tatgctcaatatcaagctccttcttctgatattcctcttgggtatgctaccgattgtcac
ttcaaagcaacaggaaacgatcccaatgatattcctataggaaagccggcttatccagat
tcatgggtttatctttgtgctaatgagcttacagagctcttgtatcgtgttaagagtaca
tataacgtatccaaacctattataattaccgaaaacggttctccggataagactgatctt
ggaaaaacttaccaagaagtacgggatgatacgtaccgaatggaatacatagaaaaacat
cttatagcaatccgtacagctatgcggaacaatgtaaacattatgggctacttcgtgtgg
tcgtttatggatagcttcgaatgggaatctggctatgatatccgattcggtatgatgtat
gtcgattatgccaacaatctgcaacggtatccgaaaaattcggcgatttggttcaagaaa
tttctttctgagacaaaaggggggtttttgaaaagaaccctaatggatggtgaggaagaa
gatgaagtcaataacgtggtgtctgaagctgaaaaagcaactgaagtgattccaaaactg
aagaaggtgaaagcatga

DBGET integrated database retrieval system