KEGG   Clostridium cellulovorans: Clocel_1150Help
Entry
Clocel_1150       CDS       T01294                                 

Definition
(GenBank) glycoside hydrolase family 5
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
ccb  Clostridium cellulovorans
Pathway
ccb00500  Starch and sucrose metabolism
ccb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Clocel_1150
Enzymes [BR:ccb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Clocel_1150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cellulase Dockerin_1
Motif
Other DBs
NCBI-ProteinID: ADL50906
UniProt: P28621
Position
1390038..1391360
Genome map
AA seq 440 aa AA seqDB search
MNKRLSRGKISLLASVFVTTTFMGGVNVLASTAKTGIRDITSQQVVKEMKVGWNLGNTMD
ATGGETNWGNPLTTHAMIDKVKAAGFNTLRLPITWDGHIGAAPDYAIDATWMNRVEEIAN
YAFDNNMYVIINLHHEDGWLKPYYANEAEVKAKITKVWTQIANRFKDYGDYLIFETMNEP
RPVGAADEWSGGSYENRDMVNRYNLTAVNTIRATGGNNALRHIMVPTLAAAALSTTMNDY
IVPNNDSRVIVSLHMYSPYFFSADLTSQWTTATWGSDADKAALSADFDAVYNKFVKNGRA
VVIGEMGTINKNNLDSRVKHAEYYAKEATVRGITPIWWDNGYCVAGKEQTFGIFNRKNLT
WCCPEVMQAFIRGAGATQTQTSYSLGDVNKDGKVNAIDYAVLKSILLGTNTNVDLSVSDM
NKDGKVNALDLAVLKKMLLS
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaagattatcacggggaaagatatctcttttagcatcagttttcgttaccaca
acttttatggggggagtaaatgttctcgcatctacagctaagacaggtattcgtgacata
acttctcaacaagttgttaaggaaatgaaggttggttggaacttaggaaatacaatggat
gctacaggaggagaaacaaattgggggaatccattaacaacacatgccatgattgacaaa
gtaaaagcagcaggctttaatactttaaggcttccaataacttgggatggtcatattgga
gcagcaccagattatgctattgatgcaacatggatgaatagagtcgaagaaatagcaaat
tatgcttttgataataatatgtatgttataataaatcttcatcacgaagatggatggctt
aagccttattatgccaatgaggctgaagtaaaagctaaaatcacaaaagtatggacacaa
attgcaaatcgctttaaagattatggggattatctaatttttgaaacaatgaatgaacct
cgtccagtaggcgcagctgatgaatggtctggtggctcctatgaaaatcgagatatggtt
aatagatataatttaacagcggtaaacactattagagctactggtggaaataatgcatta
aggcacattatggttccaactcttgcagcagcagcacttagcacaacaatgaatgattac
atagtaccaaataatgatagcagagttatagtatccttacatatgtattcaccatatttc
ttctctgcagatcttactagtcaatggactacagcaacttggggaagtgatgctgataag
gctgcactaagtgctgactttgatgcagtttataataagtttgttaagaatggaagagct
gtagttattggcgaaatgggaacaatcaataagaataatttagattctagagtgaaacat
gcagaatattatgctaaagaagcaacagttagagggataactcctatatggtgggataat
ggatattgtgttgctggaaaagagcaaaccttcggaatatttaatagaaagaatcttact
tggtgttgtccagaagttatgcaagctttcataagaggagcaggtgccacacaaactcaa
acttcttattcactaggtgatgttaacaaagatggaaaggtaaatgctatcgattatgca
gtgcttaaatcaattcttttaggtacaaatactaacgttgatttatcagtatcagacatg
aataaggatggtaaagtaaatgctttggatttagctgttcttaaaaaaatgcttttaagc
taa

DBGET integrated database retrieval system