KEGG   Clostridium cellulovorans: Clocel_1252Help
Entry
Clocel_1252       CDS       T01294                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
ccb  Clostridium cellulovorans
Pathway
ccb00010  Glycolysis / Gluconeogenesis
ccb00052  Galactose metabolism
ccb01100  Metabolic pathways
ccb01110  Biosynthesis of secondary metabolites
ccb01120  Microbial metabolism in diverse environments
ccb01130  Biosynthesis of antibiotics
Module
ccb_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clocel_1252
   00052 Galactose metabolism
    Clocel_1252
Enzymes [BR:ccb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Clocel_1252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim DUF108
Motif
Other DBs
NCBI-ProteinID: ADL51007
UniProt: D9SUV2
Position
complement(1531444..1532502)
Genome map
AA seq 352 aa AA seqDB search
MSITKELFGKTHNGEDAYIFTVKNSNGITAKLTNFGAILVALNTPDSNGNFADIVLGYDD
FEGYLENPQNLGATIGRTGNRIKDAEFYINDIKYTLAKNDGENSLHGGLNNYKKVLWNSE
IIETPDYDAVEFTYLSKDGEEGYPGNLNVKVTYSLTKDNSLKIDTEAVADKDTVVNIVNH
SYFNLGGHDSGSIFNHKLQINADTFTPIAPDIIPTGELKKVEGTPMDFRTLSQISKMIDY
NFEQIAFVNGYDHNWVLNTNGDISLLATKVLDEKTGRLMDIFTTKPGIQFYSGNFLDGAE
KGKNGVAYQKGDGLCLETQYFPNAINCPSFPSPILKANEKYTHTTIYKFSTK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattacaaaagaactttttgggaaaacacacaatggtgaagatgcatacatcttt
acggttaaaaattctaatggtataaccgctaaattaactaacttcggtgctatactagtt
gcacttaatacgcctgattctaatggcaattttgcagatatagttttaggttatgatgat
tttgaaggctatcttgaaaatccacaaaatctaggtgccactataggaagaactgggaac
agaataaaagatgcagaattctatattaatgatataaaatatacactagcaaaaaatgat
ggagaaaattctcttcatggaggccttaataactataaaaaagttttatggaattcagaa
ataattgaaactccagattatgatgctgttgaattcacatatctaagtaaagatggtgaa
gagggctatcctggaaatctcaatgttaaagttacatactccttaacaaaagataattcc
ttaaagatagatactgaggcagtagcagataaagatacagtagttaacattgttaatcat
tcctactttaaccttggtggtcatgacagtggatctatcttcaatcataaactacaaatt
aacgcagatacattcactccaatagccccagatattattcctactggtgagttgaaaaaa
gtcgaaggaacaccaatggactttagaactctttcacaaatttctaaaatgattgactat
aattttgaacaaattgcttttgttaacggctatgatcataattgggttttaaatacaaat
ggagacatttcccttttagccacaaaagttttagatgaaaaaactggaagattaatggat
atctttacaactaaaccaggaattcaattttatagcggtaattttctagatggtgcagaa
aaaggcaaaaacggagttgcttatcaaaaaggggatggcttatgtcttgaaactcaatac
ttccctaacgctataaattgcccttcttttccttcccctatattaaaagctaatgaaaaa
tacactcacaccacaatttataaattttcaacgaaataa

DBGET integrated database retrieval system