KEGG   Clostridium cellulovorans: Clocel_1871Help
Entry
Clocel_1871       CDS       T01294                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase/phosphopantothenate/cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
ccb  Clostridium cellulovorans
Pathway
ccb00770  Pantothenate and CoA biosynthesis
ccb01100  Metabolic pathways
Module
ccb_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:ccb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Clocel_1871
Enzymes [BR:ccb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     Clocel_1871
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     Clocel_1871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein Glyco_trans_4_2 Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ADL51615
UniProt: D9SL99
Position
2255236..2256423
Genome map
AA seq 395 aa AA seqDB search
MKKKTIVLGVSGGIAVYKALDVVSKLKKKDYDVHVIMTKNAMEFVTPLSFQSISQNMVIT
DMFAEPKAWEIQHISLAKKADLMVIVPATANIIGKVANGIADDMLSTTIMATKAPVIFAP
AMNTNMYQNPIVQENMSKLKGYGYEFIDTVKGRLACGDVGEGKLADTEDIVQYIESKLYD
IKDLSGKKVMITAGPTIAPIDPVRYISNYSSGKMGYAIAEEARDRGAEVVLISGDVSIPD
IKGVRIIKVKTNPDMKEAVLKEFDDAEIIIKTAAVTDFKIKNYSDIKIKKKDEGLTLELE
KDTDILKTLGSMKKNQILVGFAAESNDVIENAKAKLDKKNLDFVVANDISVSDSGFNSDD
NKVTIISRNGEELHLEKMNKRAVAKEIFNKILKKR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaagactattgttctcggtgttagtggaggaattgcagtttataaagcatta
gatgttgtttcaaagcttaagaaaaaagactatgatgtccatgtgattatgactaagaat
gctatggaatttgttacgccattatcatttcaatcgataagtcaaaacatggttattaca
gatatgttcgctgagccaaaagcttgggaaattcagcatatttctttagctaagaaagca
gatttaatggttatagttcctgcaacggctaatataattggaaaggtagctaatggaata
gctgatgatatgcttagtacaacaataatggctaccaaggcaccagttatatttgctcca
gctatgaacactaatatgtatcaaaatccaatagtacaagaaaatatgtcaaagcttaaa
ggttatggctatgagtttatcgatacagttaaaggaaggcttgcttgtggagatgttgga
gaagggaagctagctgatactgaagatattgttcaatatatagaaagtaagttatatgat
ataaaggacttgtcgggtaaaaaagttatgataacagctggacctacaattgctcctatc
gatccagttcgctatataagcaattattcatcaggaaagatgggttatgctatagctgaa
gaagcaagagatagaggggctgaagttgttttgatttcaggagatgtatctattcctgat
attaagggtgtaaggattataaaagtaaagaccaatccagatatgaaggaagcagtatta
aaggaatttgatgatgctgaaattataataaaaactgctgcggttacagactttaagatt
aaaaattattctgatataaagatcaagaaaaaggacgaaggtttaaccttagaacttgag
aaagatacagatattttaaaaactttaggttctatgaagaaaaatcaaattcttgttggt
tttgcagctgaaagcaatgatgttatagaaaatgctaaagcaaagcttgataagaaaaac
cttgattttgttgttgctaatgatatcagcgttagtgattctggatttaacagtgatgat
aacaaggttactataatatctagaaacggtgaagaacttcatcttgaaaagatgaataaa
agagccgttgcgaaagagatatttaataagatactaaaaaagcgctaa

DBGET integrated database retrieval system