KEGG   Clostridium cellulovorans: Clocel_1990Help
Entry
Clocel_1990       CDS       T01294                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
ccb  Clostridium cellulovorans
Pathway
ccb00561  Glycerolipid metabolism
ccb00640  Propanoate metabolism
ccb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Clocel_1990
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Clocel_1990
Enzymes [BR:ccb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     Clocel_1990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: ADL51734
UniProt: D9SM03
Position
2377998..2379134
Genome map
AA seq 378 aa AA seqDB search
MRKAFICPSKYVQGEDEILNLGYFVKSFGESALLIAHKDDVARVKDKLDKTSEKFGITFV
ESSFQGECSRQEVARLKQVAKENKCACTIGLGGGKAIDTAKCVAEGEALIIVPTIAATDA
PTSHSAVMYTPEGAFDDYAYFKQNPSVVLIDTTVIAKAPTRFLVSGMGDALSTYFEARAT
SNSYSNVNAGLPCGYREGVCGEAKGTNTALVLAKLCYETLLRDGSKAKAASDCNLVTQSL
ENIIEANILLSGLGFESGGLAGAHAVHDGLTILEGTHKYFHGEKVAFGTIAQLVLENSPT
EELKQVLDFCLEVGLPVCLSDIGVDSITETELMEVAKKACIKEESIHSMPFPITIEAVAA
AIITADRIGKEYKAKRGV
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagcatttatttgcccatctaaatatgtacaaggtgaagatgaaattttaaat
ttaggttattttgttaaaagttttggagaatcagctctattaatagcacataaagatgac
gtcgcacgtgttaaggataaattagataaaactagtgaaaagtttggaattacttttgtg
gaaagttctttccaaggagaatgttctagacaagaggtagcaagattaaagcaagttgca
aaggaaaacaaatgtgcttgcacaattggtcttggtggtggtaaggcaattgatacagct
aaatgtgttgcagaaggggaagcgttgattatagttccaactatagctgctacagatgca
cctacaagtcattcagcagtaatgtacacaccagagggagcttttgatgactatgcttac
tttaaacaaaatccaagtgtggttttaatagatactacagtaattgcaaaggcaccaact
cgctttttagtttcaggaatgggagatgcattgtcaacatattttgaagcaagagcaact
tcaaattcatattccaatgtaaatgcaggtctaccttgtggatatagagaaggagtatgt
ggtgaggcaaaaggaactaatacagctttagttcttgcaaagttatgttatgaaacactt
cttagagatggatcaaaagcaaaagctgcttcagactgcaatttagttacacaatcttta
gaaaatattattgaagcaaacatccttttatcaggtcttggctttgaaagtggtggtttg
gctggagctcatgcagttcacgatggattaactatattagagggaactcacaaatacttc
catggtgaaaaggttgcctttggtactattgcccaattagtattagaaaattcacctact
gaggaattaaagcaagtattagatttttgcttagaagttggtctaccagtttgtttatca
gatattggagttgacagcataacagagactgaacttatggaagttgctaaaaaagcatgt
atcaaagaagaatcaatccattctatgccattcccaataactatagaagctgtagcagcc
gcgattataacagcagatagaataggtaaggaatacaaggcaaaaagaggagtgtaa

DBGET integrated database retrieval system