KEGG   Clostridium cellulovorans: Clocel_2162Help
Entry
Clocel_2162       CDS       T01294                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ccb  Clostridium cellulovorans
Pathway
ccb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ccb01100  Metabolic pathways
ccb01110  Biosynthesis of secondary metabolites
ccb01130  Biosynthesis of antibiotics
ccb01230  Biosynthesis of amino acids
Module
ccb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clocel_2162
Enzymes [BR:ccb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Clocel_2162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C NanE His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADL51905
UniProt: D9SN39
Position
complement(2576046..2576822)
Genome map
AA seq 258 aa AA seqDB search
MPNILQVIIEKKREDLEKLDRETLHNEALKLKDKPSISLRKALIESSAMGIISEIKRASP
SKGDLNINLQVEEVAKTYMESGAKGISVLTEENYFKGSYNDLKKVREIVNIPILNKDFFI
DKIQIDLCKIYGGDVILLILSALNDDEAKELLDYAHSFNLEVLMEVHDEEELLRAFKLNP
DIIGVNNRNLKTFEVSINNTLNLSKYFVDDRLIISESGIKTKEDVKALKENNVRGMLIGE
TFVTSKSLKETFKELTDV
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcctaatattttacaagtaattatagaaaaaaagcgagaagatttagaaaagttagat
agagaaactcttcacaatgaagcactaaaattgaaagataagcctagtatttccttaaga
aaggcattaatagaaagcagtgccatgggaattatttctgaaattaaaagagcttcacct
tctaagggggatttaaatataaacttacaagttgaagaagttgccaaaacttatatggaa
agtggcgctaaaggaatatctgtactaactgaggaaaattattttaaaggtagctataat
gacttaaagaaagttcgtgaaatcgtaaatattccaatactaaataaggatttctttatt
gataaaattcaaatcgatttatgtaaaatctatggtggtgatgtaattttactaatcctt
agtgctttaaatgatgatgaagcaaaagaacttctagattacgctcattcatttaatctt
gaagtattaatggaagttcatgatgaagaagaactgttaagagcctttaaattaaaccca
gatattataggtgtaaataatagaaatcttaagactttcgaagtttcaataaataatacc
cttaacctttcgaaatactttgtagatgatagattaatcatttctgaaagtggtattaaa
acaaaagaagatgttaaagcattaaaagaaaataatgttcgcggaatgcttataggagaa
acttttgttacttccaaatccttaaaagaaacttttaaggagctaacagatgtctaa

DBGET integrated database retrieval system