KEGG   Clostridium cellulovorans: Clocel_3058Help
Entry
Clocel_3058       CDS       T01294                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ccb  Clostridium cellulovorans
Pathway
ccb00071  Fatty acid degradation
ccb00280  Valine, leucine and isoleucine degradation
ccb00362  Benzoate degradation
ccb00380  Tryptophan metabolism
ccb00620  Pyruvate metabolism
ccb00630  Glyoxylate and dicarboxylate metabolism
ccb00640  Propanoate metabolism
ccb00650  Butanoate metabolism
ccb00900  Terpenoid backbone biosynthesis
ccb01100  Metabolic pathways
ccb01110  Biosynthesis of secondary metabolites
ccb01120  Microbial metabolism in diverse environments
ccb01130  Biosynthesis of antibiotics
ccb01200  Carbon metabolism
ccb01212  Fatty acid metabolism
ccb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ccb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Clocel_3058
   00630 Glyoxylate and dicarboxylate metabolism
    Clocel_3058
   00640 Propanoate metabolism
    Clocel_3058
   00650 Butanoate metabolism
    Clocel_3058
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Clocel_3058
   00072 Synthesis and degradation of ketone bodies
    Clocel_3058
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Clocel_3058
   00310 Lysine degradation
    Clocel_3058
   00380 Tryptophan metabolism
    Clocel_3058
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Clocel_3058
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Clocel_3058
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Clocel_3058
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccb04147]
    Clocel_3058
Enzymes [BR:ccb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Clocel_3058
Exosome [BR:ccb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Clocel_3058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III SpoVAD
Motif
Other DBs
NCBI-ProteinID: ADL52748
UniProt: D9STL4
Position
complement(3751872..3753056)
Genome map
AA seq 394 aa AA seqDB search
MRDVVIVSAVRTAVGTFGGSLKSVPAAELGAIVIKEAVSRAGISGDQVDEVVLGNVISAG
LGQNVARIATVKSGLPEEVPAMTINKVCGSGLRSVSLACQMIQSGDADVVVAGGMENMSL
APYILPTTRWGQRMGDGKIVDAMINDALTDAFYGYHMGITAENIAEKWNLTREMQDEFAA
SSQQKAEVAVKAGRFKDEIVPVTIPQRKGDPIVFDTDEFPRFGTTAASLGKLKPAFKKDG
TVTAGNASGINDGAAALVVMSAEKAAQLGVKPLVKIVSWGSKGLDPQIMGYGPVASTRVA
LERANLSVADLDLIEANEAFAAQSLAVAKDLEFDMSKVNVNGGAIALGHPVGASGARILV
SLIHELQKREDAKLGLATLCIGGGQGTAVIVEKC
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagagatgtagtaatcgtaagtgcagttagaactgcagtaggtacttttggaggttca
ttaaaatctgttccagcagcagagttaggagctatcgttattaaagaagcagtgagcaga
gcaggtataagcggagaccaagttgacgaagttgtattgggtaacgttatatcagcagga
cttggacaaaatgtagcaagaatagctacagttaaatcaggtcttccagaagaagttcct
gcaatgacaattaataaagtttgtggttcaggtttaagatctgtatcattagcttgccaa
atgattcaatctggtgatgctgatgttgtagttgctggaggtatggaaaacatgtcttta
gcaccatatatattaccaacaactagatggggacaaagaatgggtgatggaaaaatcgtt
gatgctatgataaatgatgcgttaacagatgctttctatggataccacatgggtattact
gctgaaaacatagcagaaaaatggaacttaactagagaaatgcaagatgaatttgctgca
agttcacaacaaaaggctgaagttgctgttaaagcaggtagattcaaggatgaaatagta
ccagttactattccacaaagaaaaggtgacccaatagtatttgatacagatgaattccca
agatttggaacaacagctgcatcattaggtaaattaaagccagcattcaagaaagacgga
acagttacagctggtaatgcatcaggtatcaatgatggtgctgctgcactagtagttatg
agtgctgaaaaagcagctcaattaggtgttaaacctttagttaaaattgtttcatgggga
tcaaaaggattagatccacaaatcatgggatacggaccagttgcttcaacaagagttgct
cttgaaagagcaaacctttcagttgctgatttagatcttatcgaagcaaatgaagctttt
gctgctcaaagtttagcagttgctaaagatttagaattcgatatgagcaaagttaatgta
aatggtggagctattgctcttggacatccagttggtgcttcaggtgctagaatattagtt
tcattaattcacgaattacaaaaaagagaagatgctaaattaggtcttgctacattatgt
ataggtggcggacaaggaacagctgtaatagttgaaaaatgctaa

DBGET integrated database retrieval system