KEGG   Clostridium cellulovorans: Clocel_3728Help
Entry
Clocel_3728       CDS       T01294                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ccb  Clostridium cellulovorans
Pathway
ccb03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ccb00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Clocel_3728
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ccb03011]
    Clocel_3728
Ribosome [BR:ccb03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Clocel_3728
  Bacteria
    Clocel_3728
  Archaea
    Clocel_3728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ADL53398
UniProt: D9SX95
Position
complement(4498858..4499193)
Genome map
AA seq 111 aa AA seqDB search
MEAKAIARYIRMSPTKVNIVLDLIRGKNVNEAFAILQYTPKDAAVVVNKLLKSAVANAEN
NLNLSRENLYVSDAHTGQGPTLKRFRPHAQGRAFSIKKRTSHITLVVKERA
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaagctaaggctatagctagatatataagaatgtcaccaacgaaggtgaacatagtg
ttagacttaataagaggtaaaaatgtgaatgaagcattcgcaattttacaatatactcct
aaggatgcagcagttgtagtaaataaattacttaaatccgctgttgctaacgcagaaaac
aatttaaatttaagcagagagaacttatatgtttctgatgctcatacaggtcaaggtcca
actttaaagagatttagaccacatgcacaaggaagagcatttagcattaaaaagagaaca
tctcatataactctagtagttaaagaaagagcgtag

DBGET integrated database retrieval system