KEGG   Ruminiclostridium cellulolyticum: Ccel_2582
Entry
Ccel_2582         CDS       T00835                                 

Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
cce  Ruminiclostridium cellulolyticum
Pathway
cce00620  Pyruvate metabolism
cce00640  Propanoate metabolism
cce00650  Butanoate metabolism
cce01100  Metabolic pathways
cce01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ccel_2582
   00640 Propanoate metabolism
    Ccel_2582
   00650 Butanoate metabolism
    Ccel_2582
Enzymes [BR:cce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     Ccel_2582
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: ACL76910
UniProt: B8I6R8
Position
complement(3113820..3116048)
AA seq 742 aa
MDPWRYFKNGNWSEEIDVRDFIINNYIPYKGDDSFLKGPTEKTQKLWKKVSGILDEEREN
GGVLDVDTKIISTITSHEPGYIDKDLEKIVGLQTDKPLKRGIMPFGGIRMVVKGGEAYGK
KIDESVVKLFTEYRKTHNDGVYDVYTPEMMRAKKAGIITGLPDAYGRGRIIGDYRRVALY
GVDRLIGDKQKQLTSLEMDYMDSETIQEREERKSQIKALEYLKQMAEMYGFDISRPAETA
QEAFQWLYFGFLGAVKEQNGAAMSLGRVSTFLDIYIERDMKEGTLTEEEAQELVDHFVMK
LRLVRFLRTPEYEKLFSGDPTWITESIGGMGLDGRTLVTKNSFRMLHTLFNLGHAPEPNM
TVLWSVHLPDGFKKYCSYVSINTSSIQYESDDIMRYYWGDDYGIACCVSAMRIGKQMQFF
GARCNMAKALLYAINGGRDEKSGVQVGPIMQAIETEYLDYDDVIKRFDAVLTWVARLYIN
TLNIIHYMHDKYAYERLQMALHDKDILRTMACGIAGLSVVADSLSAIKYAKVKVIRNEEG
LAVDYDIEGDYPKFGNNDDRVDNIAVMLVKSFMEKLEKQRTYRHSVPTLSILTITSNVVY
GAKTGNTPDGRKAGEPFGPGANPMHGRDLNGALAVLKSISKLPYQFAQDGISYTFSIVPK
ALGKEEDTRINNLVSLLDSYFKEGGHHININVFEREMLLDAMDHPEKYPQLTIRVSGYAV
NFIKLTREQQLDVINRTIHENI
NT seq 2229 nt   +upstreamnt  +downstreamnt
atggatccatggagatatttcaaaaacggaaattggtccgaggaaatagatgtaagggat
tttattattaataattatataccatataaaggagatgattcctttttaaaaggccctact
gaaaagactcaaaaactctggaaaaaagtcagtggtatccttgacgaggaaagagagaac
ggaggagttctcgatgttgataccaaaataatatcaactatcacttcgcatgaacccgga
tatattgataaggatttggaaaagattgtaggattgcagacggataaacctctaaaaagg
ggtataatgcctttcggtggtatcaggatggtagtaaagggcggagaggcctacggcaaa
aagattgacgaaagtgttgtaaagctatttactgaatataggaagactcacaatgacggt
gtttacgatgtctatactcccgaaatgatgagggcgaaaaaagcaggtattataaccggg
cttcctgatgcatacggtagaggaagaataatcggtgattacagaagagttgcactgtat
ggggttgacaggcttatcggagataagcaaaaacaacttacaagcctagaaatggattac
atggacagtgaaaccatacaggaaagggaagaaagaaaaagtcagataaaagctcttgag
tacttaaagcaaatggctgaaatgtatggctttgatatttcaaggcctgctgaaaccgca
caggaagcatttcaatggttgtatttcggtttcctcggagcagtaaaggagcagaatggt
gcggctatgagtcttggaagagtttcaacattccttgatatttatatagaaagggatatg
aaggaggggacacttaccgaagaagaggcacaggagcttgttgaccattttgttatgaag
cttagattagtaagattcctgagaactccagagtatgagaaactgttctcaggtgaccct
acatggataaccgaaagcattggaggtatgggtcttgacggacgtactctggtaacgaag
aattccttcagaatgctgcataccctatttaatctgggtcatgcacccgagcccaatatg
acggtgctttggtcggtgcatctgcctgatggctttaagaaatactgctcatatgtttct
atcaatacaagctctatccaatacgagagcgatgatataatgaggtattattggggagac
gactacggcatagcatgctgtgtttcagccatgagaataggaaagcagatgcagttcttc
ggagcccgctgcaatatggcgaaagctttgttgtatgcaattaacggggggcgtgatgaa
aaatcgggcgttcaggtaggacctataatgcaggctattgagactgaatatcttgattat
gatgatgtaataaagaggttcgacgcagtactaacatgggttgcaagactttacatcaac
actctgaatataatacactatatgcatgacaagtacgcttatgaaagactacagatggct
ttgcacgacaaggacatattaagaacaatggcctgcggaatagcaggattatctgtagtt
gcggattctctgagtgcaattaaatatgcaaaggtaaaggtaataagaaatgaagagggg
cttgccgttgactatgacatagaaggtgattatccgaaatttggaaataacgacgaccgt
gtagacaatatagccgtaatgctggtaaaaagctttatggagaagctggaaaagcagaga
acctacaggcactctgttcctaccctttcaatactgactattacatcaaatgttgtatac
ggagctaagacaggtaatacacctgacggaagaaaagcgggagaacccttcggaccgggt
gcaaacccaatgcacggaagagacttgaacggtgcacttgcagttcttaaatccatttca
aagctgccttaccagtttgcacaggacggtatatcatacactttttcaatagtaccaaag
gcacttggaaaagaggaagatacaaggatcaacaaccttgtgtcactgcttgactcttac
tttaaagaaggcggacatcacattaatatcaatgtatttgagagagaaatgctgctggat
gcaatggatcatcctgaaaagtacccacagctcacaatcagggtatccggctatgcggta
aactttataaaattgacgagggaacagcagctagatgtaattaacagaacgatacatgaa
aatatatag

DBGET integrated database retrieval system