KEGG   Ruminiclostridium cellulolyticum: Ccel_2858
Entry
Ccel_2858         CDS       T00835                                 
Name
(GenBank) conserved hypothetical protein
Organism
cce  Ruminiclostridium cellulolyticum
SSDB
Motif
Pfam: DUF2815
Other DBs
NCBI-ProteinID: ACL77152
UniProt: B8I852
Position
complement(3410668..3411216)
AA seq 182 aa
MNNQNRTKVVTSVNTRLSYFHGWEPVSINGGAEKYSVSVLIPKTDKETINAINAAVDAAI
EEGLAKFGGKKPNKAAIKLPLRDGDVERDDEAYKGHYFVNANSTTPPQIVDKAVKPILDR
NEVYSGCYARVSLNFYAFNSNGNKGVACGLGNIQKIRDGEPLGGRTNAADDFTTIEDDDF
LA
NT seq 549 nt   +upstreamnt  +downstreamnt
atgaataatcaaaacagaacgaaggttgttacaagcgtcaacacacgtcttagctacttt
cacggctgggagcccgtatcgatcaatggcggagcagaaaagtatagcgtatctgtattg
attcccaaaacagataaggaaaccatcaatgctatcaatgcagcagtagatgcagccatt
gaagagggtcttgcaaagtttggtggaaaaaagccgaataaggcagctattaaactgcca
cttcgagatggtgacgtagaacgagatgatgaggcttataaaggacattatttcgtaaat
gccaacagtactactccgcctcagattgtagataaagcagtcaagcccattctggatcgc
aacgaggtttacagtggttgttatgcaagagtatccctaaatttctacgcttttaactct
aatggcaataagggtgtggcttgtggtcttggtaacattcagaagataagagatggagag
cctttaggtggaagaaccaatgcagctgatgatttcacaactattgaagatgatgatttt
ctagcataa

DBGET integrated database retrieval system