KEGG   Clostridium cellulolyticum: Ccel_0494Help
Entry
Ccel_0494         CDS       T00835                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cce  Clostridium cellulolyticum
Pathway
cce00010  Glycolysis / Gluconeogenesis
cce00620  Pyruvate metabolism
cce00640  Propanoate metabolism
cce00680  Methane metabolism
cce01100  Metabolic pathways
cce01110  Biosynthesis of secondary metabolites
cce01120  Microbial metabolism in diverse environments
cce01130  Biosynthesis of antibiotics
cce01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ccel_0494
   00620 Pyruvate metabolism
    Ccel_0494
   00640 Propanoate metabolism
    Ccel_0494
  Energy metabolism
   00680 Methane metabolism
    Ccel_0494
Enzymes [BR:cce01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Ccel_0494
Lipid biosynthesis proteins [BR:cce01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Ccel_0494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACL74876
UniProt: B8I6I4
Position
complement(570422..572080)
Genome map
AA seq 552 aa AA seqDB search
MLEKYLSQVDFTSYEDFYENFKIKVPENFNFAYDVVDEYAKTDPDKVAIIWCDKSGAETT
FTFGQLKEYSDKTANFFQSLGIKRGDPVMLILKRRYEFWFCILALHKLGAVTIPATHLLT
SKDIVYRANAADIKMIVCVNEPEVIKHIEDSESKTPTVKYKALINGAKDGWLDFSSGIQE
ASSQFERPRGDLGSHNSDISLLYFTSGTTGMPKMVQHDYEYPLGHILTASYWQNVSEGGL
HLTVADTGWAKAVWGKIYGQWLAGCAVFVYDFDKFVPKELLEVISKYNVTSFCAPPTIYR
FFIKEDLSKFDLSSLKYCTVAGEPLNPEVYSQFYKATGIKLMEAFGQTELTVTLSTFPWM
EPKPGSMGKPSPGYDIDLIDENGNSCQDGEEGQIVVRTSKRKPAGMFGGYYRDEALTKSV
WHDGVYYTGDMAWRDEDGYYWFVGRADDVIKSSGYRIGPFEVESALLEHPAVLECAITAV
PDLIRGQIVKATVILAKNYNPSDELVKELQDHVKKVTAPYKYPRIIEFVSELPKTISGKI
RRVEIRQTDDNK
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgttggaaaaatacttatctcaggtagactttacatcgtatgaggatttttacgaaaac
tttaaaataaaagtacctgagaactttaattttgcttatgacgtggtcgatgaatatgca
aaaacagatccagacaaggtggcaattatttggtgtgataaatcgggagccgagacaact
tttacattcggtcagttaaaggagtatagcgataagactgctaacttcttccagtcattg
ggaattaagaggggtgaccctgtaatgcttatattaaagaggcgttacgagttctggttc
tgtattttggctttacataagctaggtgctgttacaataccggcaacacatcttcttact
tcaaaggacatagtttacagggccaatgccgcagacatcaaaatgattgtttgtgttaac
gaacccgaagttataaagcatatagaagattctgagagcaaaacacctacagtaaaatat
aaggcactgattaatggtgccaaggatggctggttggatttttcatccggtattcaagaa
gcttcaagccaatttgaaagaccccggggcgatttaggttcacataatagcgacatatca
ttgttgtactttacttcgggtactacaggtatgcccaagatggttcagcatgattatgaa
tatcctttgggacatatccttacagccagttactggcaaaatgtttctgaaggaggtctg
cacctaacagttgctgatacaggctgggctaaagccgtttggggtaagatttatggtcag
tggcttgcaggatgtgccgtatttgtatatgactttgataagtttgttccaaaggaactt
cttgaagttatttcaaagtacaatgttacttctttttgtgctcctcctacaatttacaga
ttttttatcaaggaagatctttcaaaatttgatctcagcagtctgaaatattgcactgta
gcgggggaacctcttaatccggaggtatacagccagttttacaaggctacgggcataaag
cttatggaagccttcggccagacagaattaactgttacactgagcactttcccctggatg
gaaccaaagccgggatcaatgggtaaaccttctccgggctatgacatagatcttattgat
gaaaacggaaattcatgtcaggatggtgaagaaggtcagattgttgttcgtacctctaag
agaaaacctgccggtatgttcggaggttactacagagatgaagccctgactaagagtgta
tggcatgatggtgtctattatacaggtgatatggcgtggcgtgacgaagatggctattac
tggtttgttggcagagctgatgatgtaattaaaagctccggttacagaatcgggcctttt
gaggttgaaagtgctttgttggagcatcctgccgtattggaatgtgccatcacagctgtc
cctgaccttatcagaggtcagatcgtaaaagctactgttatacttgctaaaaactacaat
ccaagcgatgaactggtaaaggaacttcaggatcatgtcaagaaggttacggcaccttac
aagtatcctagaattattgagtttgtaagtgagcttcctaaaaccataagcggtaaaatc
agacgtgttgaaataagacagacagatgataataagtaa

DBGET integrated database retrieval system