KEGG   Clostridium cellulolyticum: Ccel_1013Help
Entry
Ccel_1013         CDS       T00835                                 

Definition
(GenBank) glycoside hydrolase family 2 TIM barrel
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
cce  Clostridium cellulolyticum
Pathway
cce00052  Galactose metabolism
cce00511  Other glycan degradation
cce00600  Sphingolipid metabolism
cce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Ccel_1013
  Lipid metabolism
   00600 Sphingolipid metabolism
    Ccel_1013
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Ccel_1013
Enzymes [BR:cce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Ccel_1013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Bgal_small_N Glyco_hydro_2_N DUF4981 Glyco_hydro_2 BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: ACL75375
UniProt: B8I9B5
Position
1258840..1261941
Genome map
AA seq 1033 aa AA seqDB search
MSREWENQYITQINRYPMHSPYGAYESVEQAMSCNRWTSKYVKSLSGIWKFKLAQNPQQA
PENFYALNYDVSDWDDIPVPSNWELHGYGKPVYTNIIYPFKREGVGSHYEIEVAEGQVEL
NAPLVPEKNLTGCYRTDFEVPDYFEGKDVFIEFGGVESCFYLWVNGTEIGFSKDSKLDAS
FDITHAVHSGKNELAVKVLQYCDASYLEDQDYWHLSGIYRDVRIYAKNKQRLLDYKVETL
FKDNNFKEAELRVMLQPNNRVRGYGESYVRLSLYNAENELVTAFQSQPYAKCGVYLESKF
TAFPSAFVKNPHLWSAEEPYLYTLVLETVDKNGCVTDIESTKVGFRKVEIGRDGVFYLNG
RRLLVRGVNLHEFCPETGRYVSMEYMRQQILSMKQMNFNAVRTSHYPHASEWYELCDQLG
IYVVDEANLETHGFGGQLSSSAEWTAAYLERATRMVLRDKNHPSIIIWSLGNESGAGANH
AAMYGWIKEYDKTRYVQYESCNPESNITDIICAMYPAKDWVEQKMAEHDDLRPFIMCEYA
YAKSNSNGNFKLYWDLVEKYPRFQGGFIWDFQDKALVKQQENGTSRYVYAGAFNEEVVDP
IEDMCLNGVVLPDLDWKPAAFEIRNCQAPVTIFHDGSTYPEAGDYKIKNNYMFKDLSHLY
LTWELLCDGKIVDRGVIKQYFTAPGQSDILEYALKPEKISGEAFVNITVSLNEDVPYAKK
GHVIYAYQIPLQESVLKMQKVCINHNKLTMHETAGEILILGENTEVRFDKESCIFTKAVF
NGIESFWGGRDNFYRASTGIDEGCRNPGGNYSTDWKDWGLNDLKIKDIKVDTAVSESQIF
IFTNVSYNDDKLIVSTQYRIGSRGMEVDKTVINNCPGETIPRIGFSLMLPEDKQQITWYG
RGPWENYADRKEAALIGCYSSTVPEQYTHYVKPVECGGKEDVRYIIVQDKGGHGLRVSGT
VPFHFDIHDYSVEACDNAMYEHELIKDKYVHLNIDHLHAGLGGDNGWSKNIHTEYRIGKG
CYHYQILIEVVDN
NT seq 3102 nt NT seq  +upstreamnt  +downstreamnt
atgagcagagaatgggaaaatcagtatataacacaaataaacaggtatccgatgcactcg
ccatatggagcttatgaatctgttgaacaggccatgagctgtaaccgctggacttcaaaa
tatgtaaaaagcctgagcgggatatggaagttcaagcttgcccaaaatccacagcaggca
ccggaaaatttctatgcattaaattatgatgtttccgactgggatgatatacccgtacct
tcaaactgggagctgcatgggtatggcaaaccggtttataccaatattatatatccattt
aagagggaaggagtcggatcgcactatgagatagaggtagcggagggacaggtagagctt
aatgcacctctggtacctgaaaaaaacttgacaggctgttaccgaaccgattttgaagtg
ccggattattttgaaggaaaggatgtatttatagaattcggaggtgtagagtcctgtttt
tacctttgggtaaacggtacggaaataggcttttccaaggatagcaagctggatgcttcc
tttgatatcacacatgccgtacatagtggaaaaaatgaactggcagtaaaggtactacaa
tactgtgacgcctcgtaccttgaggatcaggactactggcacttgtcaggaatataccgg
gatgtgagaatttatgcaaagaacaaacaacggctgcttgactacaaggtagaaactctg
tttaaggacaataattttaaagaagccgaactgagagtaatgcttcagccaaataataga
gtcaggggttatggagaatcttatgtgagattgagtctttataacgctgaaaatgagttg
gtgactgcttttcagagtcaaccctatgccaaatgcggagtatatctggagtctaaattt
actgcttttccgtctgcatttgtgaaaaatccccatttatggtctgctgaggagccgtat
ttatatactttggttttggagacggtagacaaaaacggatgtgtcacagatattgaaagt
acaaaagtaggcttccgtaaagtagaaataggcagggacggtgtgttttacctgaacggc
aggagactactggtgcggggagtgaatttacacgaattctgtcccgaaactggaagatat
gtttcgatggaatatatgagacagcagattttatccatgaaacagatgaatttcaatgcc
gttcgaaccagccattatccccatgcaagtgaatggtatgagctttgtgatcagctggga
atatatgttgttgatgaggccaatcttgaaacccatggttttggcggacagttaagttcg
tccgcagaatggactgcggcatacttggaacgtgctactcgaatggtactcagagataag
aatcatccttctattatcatctggtcgctggggaacgaatctggggcaggtgctaaccat
gcggctatgtatggttggataaaagaatatgacaaaacaaggtatgttcagtatgaatcc
tgcaaccctgaaagcaatattaccgatattatctgtgcaatgtatccagcaaaagactgg
gtggagcaaaagatggcagagcatgatgacctgagacccttcataatgtgtgaatatgcc
tatgccaaaagcaacagcaatggcaattttaaactatattgggacttggtggagaagtat
ccacgtttccagggcgggttcatatgggactttcaagataaggcacttgtaaagcagcag
gaaaacgggacctcaagatatgtatatgcaggagcttttaatgaggaggtagttgacccc
atagaggatatgtgtttgaatggagtggtgctgccggatttggactggaaaccagctgca
tttgaaattaggaattgccaggccccggtgacaatcttccatgatggaagcacatatcct
gaagctggtgactataaaataaagaataactatatgtttaaggatttgagtcatttatac
cttacctgggagctactgtgtgacggaaaaatcgtggatagaggagttataaagcagtat
tttacggctccgggacagtcggatattctggaatatgccttgaaacctgagaaaatatct
ggtgaagcttttgtaaatatcacagtctcattaaatgaggatgtaccgtatgcaaaaaag
ggacatgttatttatgcatatcaaatcccattgcaggagtcggtgttaaaaatgcagaag
gtatgtattaaccataataaactgacaatgcatgaaactgccggagaaatattgatactg
ggagaaaatactgaggttcgttttgacaaggaaagctgtatattcacaaaagctgttttt
aacggaattgagagcttttgggggggccgggataatttttaccgggcttcaacgggaatt
gacgaagggtgcaggaatcccggcggcaattactcaactgactggaaggactggggctta
aatgatttgaaaataaaggacataaaagtagatactgctgtttctgaatcacaaatattt
atatttacaaacgtgtcatacaatgatgataaattgattgtttccacacagtacaggatt
ggcagtagaggtatggaggttgataaaaccgtcattaataattgtcccggtgagacaatt
ccaagaatcggattctcattaatgcttccggaggataaacagcaaataacttggtatgga
agaggaccttgggagaattacgccgacagaaaggaagcagcccttatagggtgttacagc
agtaccgtcccggaacagtatacacactatgtgaagcccgtggaatgcggcggaaaagaa
gatgtgagatacatcattgtacaggataaggggggacatggcctacgcgtttcaggcacc
gtacctttccattttgatattcatgattactctgtggaggcctgcgataatgcaatgtat
gagcatgaactaataaaggataaatacgtacacctaaatatagatcatttacatgccggc
ttgggcggagacaacggctggtcaaaaaatattcatacggagtaccgtattggaaaaggt
tgttatcattatcagatattaatagaagtggttgacaattaa

DBGET integrated database retrieval system