KEGG   Clostridium cellulolyticum: Ccel_2434Help
Entry
Ccel_2434         CDS       T00835                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
cce  Clostridium cellulolyticum
Pathway
cce00330  Arginine and proline metabolism
cce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Ccel_2434
Enzymes [BR:cce01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Ccel_2434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: ACL76764
UniProt: B8I5M8
Position
2935398..2936261
Genome map
AA seq 287 aa AA seqDB search
MINKNTLPTNFLGCESRFEDSDIVIFGAPYDGTTTFRPGTRFAPSAMRIDSIGLETYSPY
FDADISDYKIHDYGDLDLPFGSPNKALHMISETSGFIFKQGKKPLMIGGEHLVTLPSIEQ
AAKLYPDLRIIHFDAHTDLREEYIGEPLSHSTVIRRAWDILGDNRIYQFGIRSGTREEFY
WARDGHTNLCLHNFETLANAVSQISNAPVYLTIDLDVLDPSIFSGTGTPEAGGVTFLELI
NALKTVSALNIIGADIVELSPHYDHSGASTAVACKVLREVILAMQNF
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgataaataagaataccctgccaacaaattttcttgggtgcgaaagccgctttgaggat
tctgatattgtaattttcggtgctccatacgacggtacaactacctttagacccggcaca
agatttgccccttctgccatgagaattgattctataggtcttgaaacgtatagtccatac
tttgatgctgatatttccgactataaaattcatgactacggcgaccttgatctgcccttc
ggttcaccaaataaggctttgcatatgatatccgaaacgtccggatttatttttaaacaa
ggtaagaagcctcttatgattggcggtgagcatcttgttacactaccttcaattgaacag
gctgcaaaattatatcctgatctcagaattattcattttgatgctcatactgatttaaga
gaagaatacatcggagaacctttatcacactctacagttataagaagagcatgggatatc
ctgggggacaatcgcatctatcagtttggtataagaagcggaacaagagaggaattttac
tgggcaagggatggccacaccaacctttgtctccataattttgaaacacttgcaaatgct
gtatcccaaatcagtaatgcaccggtttacctgacaatagatctggatgttcttgatccg
tctatattttccggaacaggtactcctgaagctgggggagtcacctttcttgaattgata
aatgcacttaaaacagtatctgcattgaatatcattggtgctgatatagttgaactgtct
ccccactatgatcacagcggtgcatcaaccgctgttgcatgcaaggttttaagagaagta
attcttgccatgcagaatttctag

DBGET integrated database retrieval system