KEGG   Ruminiclostridium cellulolyticum: Ccel_2900
Entry
Ccel_2900         CDS       T00835                                 

Definition
(GenBank) Hsp33 protein
  KO
K04083  molecular chaperone Hsp33
Organism
cce  Ruminiclostridium cellulolyticum
Brite
KEGG Orthology (KO) [BR:cce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cce03110]
    Ccel_2900
Chaperones and folding catalysts [BR:cce03110]
 Heat shock proteins
  HSP33
   Ccel_2900
SSDB
Motif
Pfam: HSP33
Other DBs
NCBI-ProteinID: ACL77194
UniProt: B8I894
Position
complement(3456381..3457259)
AA seq 292 aa
MGDYIVRMTAAQGTVRAFGAMTTEMVGQAAEIHGLSPIATAALGRTMTAAGMMSKMLKGE
NDKLTIQLKGDGPLGGIVVVSDSKANVRGYVHNPNVYLPLNERGKLDIRTAMGYGYINVI
RDMGLKEPYIGLSQLVSGEIADDLTYYFATSEQVPSTVALGVLIDATGVIGAGGFIVQMM
PGAEEETVATLEKRLIGFPSVSKLISEGTTPEQILNMLLEGMEPKIVETVPCSFKCNCTR
ERMERNLISIGKKDLLEIFEDGKGAELQCHFCNTKYNFSHQDIENIVKENVK
NT seq 879 nt   +upstreamnt  +downstreamnt
atgggtgattatatagttagaatgactgctgcccagggaactgtaagagcttttggggcc
atgaccaccgaaatggtaggacaggcggctgaaatacacgggctgtccccaatagcgact
gctgctttaggacgaacgatgacggcagcgggaatgatgtccaagatgctgaaaggcgaa
aatgacaaattgacaatacagctaaaaggtgacgggccgttgggaggaatcgttgttgta
tctgactccaaggcgaatgtgagaggttatgtgcataatcccaatgtttacctccctctt
aacgaacgtggtaaactcgatattcgaactgcaatgggttacggttatatcaatgtcata
agggatatgggacttaaggaaccctatataggtctttcacagcttgtttccggtgaaata
gccgatgacctgacatattactttgcaacatcggaacaagtaccttctacggtagcttta
ggcgttttaatagatgctacaggagtaataggagccgggggatttatagtacagatgatg
ccaggggcagaagaagaaacagttgcaacgttggaaaaacgacttataggctttccttct
gtctcaaaactcatatcggaaggaacgacacccgagcaaatactgaatatgctattagaa
ggaatggaaccgaaaattgttgaaacagttccatgtagcttcaaatgtaattgtacgagg
gagagaatggagagaaatcttatcagtattggtaaaaaggatttacttgaaatttttgaa
gatggaaaaggtgcagaacttcaatgtcatttttgcaatacaaaatataacttttctcat
caggacattgagaatattgtaaaggaaaatgtaaaataa

DBGET integrated database retrieval system