KEGG   Ruminiclostridium cellulolyticum: Ccel_3188Help
Entry
Ccel_3188         CDS       T00835                                 

Definition
(GenBank) flavoprotein
  KO
K01598  phosphopantothenoylcysteine decarboxylase [EC:4.1.1.36]
Organism
cce  Ruminiclostridium cellulolyticum
Pathway
cce00770  Pantothenate and CoA biosynthesis
cce01100  Metabolic pathways
Module
cce_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:cce00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Ccel_3188
Enzymes [BR:cce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     Ccel_3188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein ACT
Motif
Other DBs
NCBI-ProteinID: ACL77478
UniProt: B8I0F2
Position
3719436..3719972
Genome map
AA seq 178 aa AA seqDB search
MRNIILGVTGSIAAYKAADIANILTKRGYNVDVIMTKSAMEFITPLTFQSLTKNKVYLNM
FEEITPKEIKHISLAKKADLCLIAPASANLIGKIVSGIADDMLTTVVMAMNNVPVYICPA
MNTNMYNNPIVQRNITTLSELGYRFIDPKEAVLACGDLGKGALADVETIINTVEGYFK
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatattattcttggagttacaggaagtattgcagcctacaaagcagctgacata
gcaaatatactaaccaagcgtggttacaacgtggacgttattatgacaaagagtgcaatg
gaatttattactcccctgacatttcaatccctgaccaaaaacaaggtttacttgaatatg
tttgaggagattacgccaaaagaaataaagcacatatctcttgcaaagaaagccgacttg
tgcctgattgcccctgccagtgcaaacctgataggtaagattgtatccggcatcgccgat
gatatgctgacaacagtagttatggcaatgaacaatgttcctgtttacatttgtcctgca
atgaacaccaacatgtacaacaacccaattgttcagcgaaatatcacaactctgtcagaa
ttgggttacaggtttattgatcccaaagaagctgttctggcctgcggtgaccttggaaag
ggtgcgttggctgatgtggaaacaataataaatacggtcgaagggtattttaaatag

DBGET integrated database retrieval system