KEGG   Clostridium cellulolyticum: Ccel_3216Help
Entry
Ccel_3216         CDS       T00835                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cce  Clostridium cellulolyticum
Pathway
cce00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cce01100  Metabolic pathways
cce01110  Biosynthesis of secondary metabolites
cce01130  Biosynthesis of antibiotics
cce01230  Biosynthesis of amino acids
Module
cce_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ccel_3216
Enzymes [BR:cce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Ccel_3216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh His_biosynth PK DHO_dh Dioxygenase_N NanE
Motif
Other DBs
NCBI-ProteinID: ACL77506
UniProt: B8I0V0
Position
3752395..3753177
Genome map
AA seq 260 aa AA seqDB search
MILDKIAASTKIRVENLKKEVSFSFVKSEASKLVNKSPFAFEKAVKDGELTFICEIKKAS
PSKGLISENFPYIDIAKDYEAAGAGAISVLTEPEFFLGSDQYLKDVKKTVSIPVLRKDFT
IDPYQIYEAALIGADCVLLICALLDTDTLKEYIKIADGLGLSCLVEAHDENEVKSAIEAG
SRIVGVNNRNLKTFEVDITNSIRLRELVPSDISFVSESGIRTAQDISALRRIGASAVLIG
ETLMRSGDTGAELAKLRGSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgattctggataaaatagccgctagtacaaaaatacgtgttgagaatctaaaaaaggaa
gtgtcttttagttttgtaaaatctgaggcatcaaaattggtaaacaagagtccttttgct
tttgaaaaagcagtaaaggatggtgagcttacttttatatgcgagataaaaaaagcatcc
ccttcaaaagggcttatttctgaaaattttccttatattgatatagccaaagattatgaa
gctgccggagccggagcaatctctgttttgacagaacctgaattttttcttggcagtgac
caatatttgaaagacgttaaaaaaacagttagtattcctgttcttagaaaagattttact
attgacccgtatcagatttatgaagccgccttaataggtgcggactgtgtactgcttata
tgtgccttgctggacactgataccttgaaagagtatataaagattgcagatggccttgga
ctgtcctgtcttgtagaggcccatgatgaaaatgaagtaaaaagtgcaattgaagcgggc
agcaggattgttggcgttaacaacaggaatctgaaaacctttgaggttgatataaccaac
agtattcgacttagagaacttgtaccctctgatataagctttgtatcggaaagcggtatt
cgtactgcccaagatatttcagcacttcgcagaattggtgcaagtgccgttctcattgga
gaaacccttatgagaagtggtgatacgggtgcagaactggcaaagctccgggggtctgca
taa

DBGET integrated database retrieval system