KEGG   Clostridium cellulolyticum: Ccel_3219Help
Entry
Ccel_3219         CDS       T00835                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cce  Clostridium cellulolyticum
Pathway
cce00260  Glycine, serine and threonine metabolism
cce00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cce01100  Metabolic pathways
cce01110  Biosynthesis of secondary metabolites
cce01130  Biosynthesis of antibiotics
cce01230  Biosynthesis of amino acids
Module
cce_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ccel_3219
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ccel_3219
Enzymes [BR:cce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ccel_3219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA DUF561 ThiG Dus
Motif
Other DBs
NCBI-ProteinID: ACL77509
UniProt: B8I0V3
Position
3755002..3755772
Genome map
AA seq 256 aa AA seqDB search
MSKISNAFKNGKAFIAFLTAGDPSLEKTEEFVLEMVKAGADLIEIGIPFSDPIAEGEVIQ
RANLRALSTGTTMDKVFDTVKRIRQKTQVPLVFLTYLNPVFTYGYDHFFRECSEHGVDGV
IIPDIPFEEKGELMPFSDKYNVDIISLIAPTSEERISKIASASKGFVYCVSSKGVTGVRN
EIKTDLQSIVSSVRSATKVPVAVGFGISTPQQASEIVKYADGIIVGSAIVKIIEQNGNNA
AAPLYDYVLNMKKYII
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcagtaatgcatttaaaaacggtaaggcatttatagcctttcttacagca
ggtgacccttccttagaaaagaccgaggaatttgttctggaaatggttaaagcaggtgct
gaccttattgaaataggtattccattttcagaccctatcgcagagggcgaggtcattcaa
agggcaaacctacgagcattatcaacaggaacaactatggataaagtttttgatacagtt
aaaagaatcagacaaaagacccaagttccacttgttttcctaacctatcttaaccctgta
tttacctacggttatgaccactttttcagagaatgcagcgaacatggtgttgacggcgtt
ataattcctgatatcccatttgaggaaaaaggtgagctgatgccatttagtgataaatat
aatgttgatattatttctttaattgcacctacttctgaggaacgtatcagtaaaatagca
tccgcctcaaaaggttttgtctactgtgtatcctcaaagggagtcacaggtgtacgcaat
gaaattaaaacagacctgcagtcaattgtatcctctgtcaggtctgcaacaaaagtccct
gtggctgtaggctttggtatatccacccctcagcaggcatcagagattgttaaatatgcc
gatggtattattgtgggaagtgctattgtaaaaattatcgaacaaaacggtaataatgcc
gcggcacctttatacgattatgtcttgaatatgaaaaagtatataatataa

DBGET integrated database retrieval system