KEGG   Clostridium cellulosi: CCDG5_0659Help
Entry
CCDG5_0659        CDS       T03806                                 

Definition
(GenBank) D-lyxose ketol-isomerase
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
ccel  Clostridium cellulosi
Pathway
ccel00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:ccel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CCDG5_0659
Enzymes [BR:ccel01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     CCDG5_0659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer Phage_head_chap
Motif
Other DBs
NCBI-ProteinID: CDZ23788
UniProt: A0A078KMU4
Position
I:complement(703510..704073)
Genome map
AA seq 187 aa AA seqDB search
MKAGNRMISRKQYETICEKVLKFFEKASIAITEDEKKKIEVADFGLNDIENTGLQLVTFV
NTDRVCAKEMVLFPHQTCPEHRHPEMGNSPGKEETFRCRYGKVYLYVEGEKTENPHCKPP
AGSEQYYTVFHEIVLNPGEQYTIYPNTLHWFQAGDDGAIVSEFSTHSEDSLDIFTDVRID
RIPKIGD
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctggtaatagaatgataagcaggaaacagtatgaaacaatatgtgaaaaagtg
ctgaaattctttgagaaagcttcaatagcgattaccgaagacgaaaagaagaaaattgag
gttgcggacttcggattgaatgacattgaaaatacagggcttcagttggttacttttgta
aataccgacagggtctgcgcaaaggaaatggtactcttccctcaccagacctgccccgaa
caccggcatcccgaaatgggaaattcgcccggcaaggaggaaaccttcagatgcagatat
ggaaaggtttatctctatgttgaaggcgagaaaacagaaaatccacactgcaaaccgcct
gcaggcagcgaacagtattatacagtatttcatgaaattgtgctcaatcccggcgaacaa
tatactatctaccccaatacgctgcattggtttcaggctggtgacgatggtgccattgta
tcggaattttcaacccattccgaggactcccttgacattttcaccgacgtcagaattgac
agaatcccaaagataggagattaa

DBGET integrated database retrieval system