KEGG   Clostridium cellulosi: CCDG5_1746Help
Entry
CCDG5_1746        CDS       T03806                                 

Definition
(GenBank) hypothetical protein
Organism
ccel  Clostridium cellulosi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_19 HTH_3 HTH_31 Phage_CI_repr HTH_26 DUF2207 HTH_37 HTH_23 Sigma70_r4 HTH_24 Sigma70_r4_2 MqsA_antitoxin ETRAMP Phage_terminase HypA DUF3899 FYVE GerE HTH_Crp_2 HTH_11 HTH_25 YdaS_antitoxin P22_Cro DZR HTH_17 zf-MYND
Motif
Other DBs
NCBI-ProteinID: CDZ24847
UniProt: A0A078KQV0
Position
I:complement(1871536..1872141)
Genome map
AA seq 201 aa AA seqDB search
MDQIKIGKFIAQMRKEKGLTQLQLADMLNISNKTVSKWERGNGLPEVSLMLPLCETLGIN
VNELLTGEKLTDSDYKKKAEENMMDLVKEKEESKKKILLSVIVGIITVIAGIALICVAGM
FEMAVQTRILFIALGLIVIAGGIFTACVLDMDAGTFECRYCKARFKPSAAAYIAGAHTIT
KRRLKCPECGRISYCKKRLTH
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggatcagattaaaataggcaaattcatagcccaaatgaggaaagagaaaggattaacg
caattgcagcttgccgacatgctgaacatcagcaataagacggtcagcaagtgggagcgg
ggaaatgggctgccggaagtttcgctgatgcttccgctgtgtgagactctcggaattaat
gtcaatgagctccttacgggtgaaaaattgaccgactccgactataaaaagaaagcggag
gagaatatgatggacctcgtaaaagagaaagaagaaagcaagaagaaaattttgctgtcg
gtgatagtaggtattattaccgttattgcaggaatagccctgatttgtgttgcagggatg
tttgaaatggcggtacagacgcggatactgtttattgccctcggcttaattgtgattgcc
ggcgggatttttacagcgtgtgttcttgatatggacgcaggcacatttgaatgccgttac
tgcaaggcgagattcaaaccgagcgctgctgcctatatcgcgggggcgcatacaattaca
aaaagacgtctgaaatgtccggaatgcgggagaataagctattgcaagaagaggctgacg
cactga

DBGET integrated database retrieval system