KEGG   Campylobacter coli RM1875: YSQ_03000Help
Entry
YSQ_03000         CDS       T03164                                 

Definition
(GenBank) glutamyl amidotransferase
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
ccf  Campylobacter coli RM1875
Pathway
ccf00970  Aminoacyl-tRNA biosynthesis
ccf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccf00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    YSQ_03000
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ccf03029]
    YSQ_03000
Enzymes [BR:ccf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     YSQ_03000
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     YSQ_03000
Mitochondrial biogenesis [BR:ccf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    YSQ_03000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AHK72950
Position
597165..598583
Genome map
AA seq 472 aa AA seqDB search
MFEVVIGLEVHTQLNTKTKIFCSCATSFGEAPNTNVCPTCLALPGALPVLNEEAVKKAIA
FGKAVNATINKKSVFNRKNYFYPDLPKAYQISQFDIPIVEKGELFINVKGENKRIGITRA
HLEEDAGKNIHENNYSKVDLNRAGTPLLEIVSEPELRSSDEAVAYLKKLHSIIRFLDISD
ANMQEGSFRCDANVSIRPKGDTKLYTRVEIKNLNSFRFIQKAIEYEVKRQSEAWEDGTYE
QEVVQETRLFDTTNLVTRSMRGKEEAAEYRYFPDPDLLPVLLKDEFLDTQIPELPDEKKM
RYINELGIKESDAEVLIGSLELSRFFESLIALNLNPKLCVNWLNTELMGLLKGELTIENS
PVDAIKLGTLIKRIEEGVISAKAAKDVLAHVFENPDMDIDETIEKLGLKQVSDDSAIEAV
IEQILNANADKVAEYKSGKDKLFGFFVGQTMKEGKGAFNPNKVNEILKAKLG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaagtagttataggacttgaagtacatactcaactaaacaccaaaacaaaaata
ttttgctcatgcgcaacttcttttggagaagctccaaatacaaatgtttgtcccacttgt
ttggctttaccgggtgctttacctgttttaaatgaagaagcggtaaaaaaggccatcgct
tttgggaaagcggtaaatgccactataaacaaaaaaagtgtttttaatagaaaaaattat
ttttatccagatttgcccaaagcttatcaaatttcacaatttgatattcctatagtagaa
aaaggtgagctttttatcaatgtaaagggtgaaaataaacgcataggtattacaagagcg
catttagaagaagatgcgggtaaaaatatccacgaaaataattattctaaagtagattta
aaccgcgcaggaactcctttgcttgaaattgtaagcgaacctgaacttagaagcagtgat
gaagcagtggcgtatcttaaaaaacttcattctatcatacgttttttagatatttctgat
gcaaatatgcaagagggaagttttagatgtgatgctaatgtaagtataagaccaaagggc
gatactaagctttacactagagtagagattaaaaatcttaattctttccgttttatccaa
aaagctatagaatatgaggtaaaaagacaaagtgaggcttgggaagatggaacttacgaa
caagaagtagttcaagaaaccagactttttgatacaacaaatttagttacaagaagtatg
cgtggtaaagaagaagcggcagaatatcgctattttccagatcctgatttgttgcctgtt
ttactaaaagatgaatttttagatactcaaattcctgagcttcctgatgagaaaaaaatg
cgctatataaatgaacttggtattaaagaaagcgatgcagaggtgcttataggatcgctt
gaattaagtcgtttttttgaaagtttgattgctttaaatttaaatcctaagctttgtgta
aattggttaaatactgagcttatgggacttttaaaaggggaattaacgatagaaaattcc
ccagtagatgcgatcaaacttggtaccttaatcaaacgcatagaagagggtgtgatcagt
gcaaaagcagcaaaggatgttttagctcatgtttttgaaaatccagatatggatattgat
gaaacgattgaaaagttagggcttaagcaggttagcgatgattcagctatcgaagcagta
attgagcaaattttaaatgccaatgctgataaggttgcagagtataaaagcgggaaggat
aagctctttggtttctttgtagggcagactatgaaagaaggtaagggagcctttaatcct
aacaaggtcaatgaaattttaaaagcaaagttgggctga

DBGET integrated database retrieval system