KEGG   Campylobacter coli RM1875: YSQ_03835Help
Entry
YSQ_03835         CDS       T03164                                 

Definition
(GenBank) acetyl-CoA carboxylase subunit alpha
  KO
K01959  pyruvate carboxylase subunit A [EC:6.4.1.1]
Organism
ccf  Campylobacter coli RM1875
Pathway
ccf00020  Citrate cycle (TCA cycle)
ccf00620  Pyruvate metabolism
ccf01100  Metabolic pathways
ccf01120  Microbial metabolism in diverse environments
ccf01200  Carbon metabolism
ccf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ccf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YSQ_03835
   00620 Pyruvate metabolism
    YSQ_03835
Enzymes [BR:ccf01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     YSQ_03835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp RimK GARS_A ATP-grasp_3 ATP-grasp_4 ATPgrasp_ST ATPgrasp_YheCD ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AHK73112
Position
758110..759543
Genome map
AA seq 477 aa AA seqDB search
MHKILIANRAEIAVRVIRACRDLHIKSVAVFTEPDRECLHVKIADEAYRIGTDAIRGYLD
VGRIIEIAKACGADAIHPGYGFLSENYDFAKACEEAGIIFIGPKSEVIHKMGNKNIARKL
MAQNGIPIVPGTEKLNAYSMDEIKVFAEKIGYPVILKASGGGGGRGIRVVHKEEELENAF
DSCKREALTYFNNDEVFMEKYVVNPRHIEFQILGDNYGNIIHLCERDCSIQRRHQKVIEI
APCPGISDNLRKTMGVTAVAAAKAVGYTNAGTIEFLLDDYNRFYFMEMNTRIQVEHPVTE
EITGVDLIVRQIRIAGGEILDLEQSDIKPRGFAIEARITAENVWKNFIPSPGKIGEYYPA
LGPSVRVDSHIYKDYTVPPYYDSMLAKLIIKATSYDLAVNKLERALKEFTIDIRTTIPFL
IAITKTREFRRGYFDTSFIETHMQELLENTEDRHQDNKEEVIAAIAATLKKIRESRE
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
attcataagattcttatagcaaatcgtgctgaaatagctgtccgtgtaatccgtgcttgt
agggatttacatattaaaagtgttgcggtttttacagaacctgatcgtgagtgtttgcat
gtaaaaattgccgatgaagcttatcgcataggcacagatgctataaggggttatttggat
gtaggaagaattatagaaattgctaaagcttgtggggctgatgctatacatcctggttat
ggatttttaagtgaaaattatgattttgctaaagcttgtgaggaagcaggaattattttt
ataggtccaaaatctgaagttatccacaaaatgggaaataaaaacatagctcgtaaatta
atggctcaaaatgggattcctatcgttccaggaacggaaaaattaaatgcttatagtatg
gatgaaatcaaagtatttgcagagaagataggctatcctgtgattttaaaagcttcaggg
ggtggcggaggacgaggaattcgtgtcgttcataaagaagaagaattagaaaatgctttt
gattcgtgtaaaagagaagcattgacttattttaacaatgatgaagtatttatggaaaaa
tatgtagtcaatcctcgccatatagaatttcaaattttaggggataattatggaaatatt
atccatctttgcgaaagggattgttctattcaaagaagacatcaaaaagtgatcgaaatc
gcaccttgtcctggaatttcagacaatctaagaaaaactatgggtgttactgctgtggct
gctgctaaggctgttggctatacaaatgcggggactatagaatttttacttgatgattat
aaccgcttttattttatggaaatgaatacaagaattcaagtagaacatcctgtaactgaa
gaaattacgggtgtggatttgatcgtgcgtcaaattcgtatcgcaggcggggaaatttta
gatctagaacaaagtgatatcaagccaagaggttttgctatagaagcaaggattacggct
gaaaatgtatggaaaaatttcattccaagtccaggtaagataggggagtattatccagca
cttggaccatctgtaagggtggacagtcatatttataaagattataccgtgcctccttat
tatgattctatgcttgcaaaattaatcataaaagctacaagttatgatttagcggttaat
aaacttgaaagagctttgaaagaatttaccatagatattagaacaactataccatttttg
atcgcgattactaaaacaagagaatttagaagagggtattttgacacttctttcatagaa
actcatatgcaagaattattagaaaataccgaagatcgccatcaagataataaagaagaa
gttatcgctgcaatcgcagctactttaaagaaaatacgcgaaagtagagaataa

DBGET integrated database retrieval system