KEGG   Corynebacterium casei: CCASEI_02795Help
Entry
CCASEI_02795      CDS       T03041                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ccg  Corynebacterium casei
Pathway
ccg03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ccg00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CCASEI_02795 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ccg03011]
    CCASEI_02795 (rplV)
Ribosome [BR:ccg03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CCASEI_02795 (rplV)
  Bacteria
    CCASEI_02795 (rplV)
  Archaea
    CCASEI_02795 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AHI19142
UniProt: W5XQF9
Position
567911..568273
Genome map
AA seq 120 aa AA seqDB search
MSETITSASATARFVRVTPMKARRVIDLVRGKSVAEALAILKYAPQGAAKPVAKVVASAA
ANAENNFGLDPRTLVISEAYANEGPTMRRFQPRAQGRAFMIRKRTSHITVVVESQKEGAK
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaccatcacctccgcatccgcaacggcccgtttcgttcgcgtaacccctatg
aaggcacgtcgcgtcatcgatttggtccgcggcaagtccgtcgccgaagctctggctatc
ttgaagtacgcacctcagggcgctgctaagccagtagctaaggttgtagcttctgctgca
gctaacgctgagaacaacttcggtctggacccacgcaccctggtcatctctgaggcttat
gctaacgagggtccaaccatgcgtcgcttccagccacgcgcccagggccgtgcattcatg
atccgtaagcgcaccagccacatcaccgtggtggtcgagagccagaaggaaggggccaag
taa

DBGET integrated database retrieval system