KEGG   Corynebacterium casei: CCASEI_04155Help
Entry
CCASEI_04155      CDS       T03041                                 

Definition
(GenBank) acyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ccg  Corynebacterium casei
Pathway
ccg00071  Fatty acid degradation
ccg00072  Synthesis and degradation of ketone bodies
ccg00280  Valine, leucine and isoleucine degradation
ccg00310  Lysine degradation
ccg00362  Benzoate degradation
ccg00380  Tryptophan metabolism
ccg00620  Pyruvate metabolism
ccg00630  Glyoxylate and dicarboxylate metabolism
ccg00640  Propanoate metabolism
ccg00650  Butanoate metabolism
ccg00900  Terpenoid backbone biosynthesis
ccg01100  Metabolic pathways
ccg01110  Biosynthesis of secondary metabolites
ccg01120  Microbial metabolism in diverse environments
ccg01130  Biosynthesis of antibiotics
ccg01200  Carbon metabolism
ccg01212  Fatty acid metabolism
ccg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ccg00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CCASEI_04155
   00630 Glyoxylate and dicarboxylate metabolism
    CCASEI_04155
   00640 Propanoate metabolism
    CCASEI_04155
   00650 Butanoate metabolism
    CCASEI_04155
  Lipid metabolism
   00071 Fatty acid degradation
    CCASEI_04155
   00072 Synthesis and degradation of ketone bodies
    CCASEI_04155
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCASEI_04155
   00310 Lysine degradation
    CCASEI_04155
   00380 Tryptophan metabolism
    CCASEI_04155
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CCASEI_04155
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCASEI_04155
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CCASEI_04155
Enzymes [BR:ccg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CCASEI_04155
Exosome [BR:ccg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CCASEI_04155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHI19409
UniProt: W5XS28
Position
861496..862665
Genome map
AA seq 389 aa AA seqDB search
MKQTDIVIVGAARTPFGKLLGGLSSLAATRLGSYAIRGALDKSGVDASLIDAVIMGQVLQ
AGVGQNPAKQAALGAGIPASAHTTTVNKVCLSGLSAIIDAARLLRSGEAEVVVAGGMESM
SQSPHLLPGVRGGHKYGPTTMLDHMDHDGLRAADLEISMGSLSEKYADRYPVTREEQDHC
SALSHQRALAADFSEEIVKVEVEHRKGKDVVGADEGIRDQVTAKSLGELRPAFEKNGSIT
AGNASPISDGAAAVVLTTRGKAQEKGWVPLATLRAVGQVAGPDSSLQAQPANALKAALRR
QKWEVEELDIIEINEAFAAVVVHSAKELEIDPDSVNLQGGAIAMGHPIGASGARLVVHAA
HALANGAEKAGVALCGGGGQGEALLMERN
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaacagacatagtcatcgttggtgcagcaagaacgccatttggaaagctcttg
ggtgggctctcctccttggcggcaacaaggttaggctcctatgcaatacgtggagcttta
gacaaaagcggtgttgatgcgtcactaattgacgccgttattatggggcaggtgctgcag
gcaggggttggccagaatcctgcaaagcaagcagccctcggagcaggcataccagccagc
gcacacaccacgaccgtaaataaggtgtgcctctctgggcttagcgcaatcattgacgct
gcgcgactacttcgatcaggcgaagctgaagttgtcgttgctggtggcatggagtcgatg
tcgcagtctccgcatttgttgccaggtgtacgaggtggtcacaaatacggaccaaccacc
atgctggatcatatggatcatgatggattgcgggctgccgacttggaaatttccatggga
agcctgtctgagaagtatgcggaccggtaccccgtgactagggaagaacaagaccattgc
tcggcactgtcacatcagcgggccttggccgcagacttttcggaggaaatagtaaaagtc
gaggtagagcatcgaaaaggcaaagatgttgtcggagcagacgaaggtattcgagaccaa
gtcacagcgaagtcattaggagaattgcggcctgcatttgagaaaaatgggtcgattact
gctggaaatgcttcaccaatttctgatggagcagcggcagtcgtattgaccacacgtggt
aaagcacaagaaaaaggctgggtgcctttagcgacattgcgcgctgtcggacaggtcgcg
ggaccagatagttcattgcaggcgcaaccagcgaatgctctcaaagcagctttgaggcgc
cagaaatgggaggttgaagaactagacattattgaaatcaatgaagcttttgctgcggtc
gtggttcactccgccaaagaactagagatcgatcctgactcagtgaacttgcaaggcgga
gcgatcgcaatggggcaccccattggagcttctggtgctcgccttgtcgtccatgccgca
catgccttggctaatggagcagagaaggctggcgttgctttatgcggtggcggcgggcag
ggcgaagccctacttatggaacggaattaa

DBGET integrated database retrieval system