KEGG   Corynebacterium casei: CCASEI_13800Help
Entry
CCASEI_13800      CDS       T03041                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ccg  Corynebacterium casei
Pathway
ccg00071  Fatty acid degradation
ccg00072  Synthesis and degradation of ketone bodies
ccg00280  Valine, leucine and isoleucine degradation
ccg00310  Lysine degradation
ccg00362  Benzoate degradation
ccg00380  Tryptophan metabolism
ccg00620  Pyruvate metabolism
ccg00630  Glyoxylate and dicarboxylate metabolism
ccg00640  Propanoate metabolism
ccg00650  Butanoate metabolism
ccg00900  Terpenoid backbone biosynthesis
ccg01100  Metabolic pathways
ccg01110  Biosynthesis of secondary metabolites
ccg01120  Microbial metabolism in diverse environments
ccg01130  Biosynthesis of antibiotics
ccg01200  Carbon metabolism
ccg01212  Fatty acid metabolism
ccg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ccg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CCASEI_13800
   00630 Glyoxylate and dicarboxylate metabolism
    CCASEI_13800
   00640 Propanoate metabolism
    CCASEI_13800
   00650 Butanoate metabolism
    CCASEI_13800
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCASEI_13800
   00072 Synthesis and degradation of ketone bodies
    CCASEI_13800
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCASEI_13800
   00310 Lysine degradation
    CCASEI_13800
   00380 Tryptophan metabolism
    CCASEI_13800
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CCASEI_13800
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCASEI_13800
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CCASEI_13800
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccg04147]
    CCASEI_13800
Enzymes [BR:ccg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CCASEI_13800
Exosome [BR:ccg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CCASEI_13800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AHI21308
UniProt: W5Y481
Position
3030855..3032090
Genome map
AA seq 411 aa AA seqDB search
MTNQNDNDIVFCSPLRTPVGRYGGVFKDVPVEDLATTVVDAIVERTGTTAKDVDDIILGQ
ASPNGAAPALGRIVALNSALGKEVPGMQLDRRCGSGLQALMTAAAHVAMGAADLIIAGGA
ESMSRTEYTVDGSIRWGVKGGDMQLRDRLAEARETAGGKNHPIPGGMIETAENVRREYKL
TREAQDQMAAASHERALKAQAENWFEEEIVPVTIPAKKRGQEPTVVTADEGPREGSTPEK
LASLRSIRGKQDEEATVTAGNASSQNDGAAAMIVTTRAKAAELGLTPLLSLKGWAVAGVA
PETMGVGPVPATKKALERTGVSLDDLDAIELNEAFAAQALAVLQEWDLAWDDSRLNTWGS
GISLGHPVGATGARMLVTLAHRLKREGGQLGLATMCIGGGQGMAAVVEKEG
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaccagaacgataatgacattgtcttttgctccccactgcgcactccagtggga
cgctacggcggagtattcaaggatgttccggtagaagatctggctaccaccgtggtcgat
gccatcgtggagcgcaccgggaccaccgccaaggacgtagatgacattatcttgggccag
gcgagcccgaatggtgcagcaccagcacttggtcgcatcgttgcgctgaactcggccttg
ggcaaggaagtaccgggcatgcagctggatcgccgttgtggttcgggcctgcaggcactc
atgaccgcggccgcacacgtggctatgggcgcggctgatctcattatcgctggtggcgcg
gagtctatgtcgcgcaccgagtacaccgttgatggctccatccgctggggtgtcaagggc
ggcgacatgcagctgcgtgaccgcctggctgaggcacgtgagaccgctggcggcaagaac
cacccaattcctggcggcatgattgaaaccgctgagaacgttcgccgcgagtacaagctc
acgcgcgaagcacaggaccagatggcagcagcatcgcacgagcgcgcgctgaaggcacaa
gcagagaactggttcgaggaagaaatcgtgccagtcaccattcctgccaagaagcgtggc
caggagccaaccgtcgtgaccgccgatgagggcccacgcgagggttccaccccagaaaag
cttgcttcgctgcgctctatccgcggcaagcaggatgaagaagcaaccgtgaccgcgggt
aacgcatcctcgcaaaacgatggcgccgcagcgatgattgttactacccgcgccaaggcc
gctgagctaggacttaccccgctgttaagcctcaagggctgggctgttgcaggtgtcgcg
ccagagaccatgggcgttggcccagttccagcaaccaagaaggcactggagcgcaccggc
gtcagcttggatgacctggatgcaattgagctcaacgaagctttcgcggcgcaggcactc
gctgtgctgcaggaatgggacttagcgtgggatgattcccgcctgaacacttggggttcg
ggtatctccctgggtcacccagttggcgcgaccggcgcccgcatgctggtgactttggcg
caccgcctcaagcgcgagggtggccagttgggtcttgccaccatgtgcatcggtggcggt
cagggcatggcagcagttgtagaaaaggaaggctaa

DBGET integrated database retrieval system