KEGG   Chlorobium chlorochromatii: Cag_0338Help
Entry
Cag_0338          CDS       T00290                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cch  Chlorobium chlorochromatii
Pathway
cch00020  Citrate cycle (TCA cycle)
cch00640  Propanoate metabolism
cch00660  C5-Branched dibasic acid metabolism
cch00720  Carbon fixation pathways in prokaryotes
cch01100  Metabolic pathways
cch01110  Biosynthesis of secondary metabolites
cch01120  Microbial metabolism in diverse environments
cch01130  Biosynthesis of antibiotics
cch01200  Carbon metabolism
Module
cch_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cch_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cch00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cag_0338
   00640 Propanoate metabolism
    Cag_0338
   00660 C5-Branched dibasic acid metabolism
    Cag_0338
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Cag_0338
Enzymes [BR:cch01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Cag_0338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABB27611
UniProt: Q3ATR4
Position
complement(379999..381171)
Genome map
AA seq 390 aa AA seqDB search
MNIHEYQGKDILRKFGVTVPKGIVAYSADEAKQAAEQLFAETGSSVVVVKAQIHAGGRGK
AGGVKLAKSPEEAFEIARQMIGMTLITHQTGPEGKVVSRLLIEEGMGIEKEFYVGITLDR
ATSRNVLMVSTEGGMEIETVAEETPEKLLKIQIDPLFGMQGFQAREAAFFLGLEGEQFRN
AVNFITALYKAYTSIDASVAEINPLVVTSEGKVIALDAKINFDDNALYRHKEYMELRDTS
EEDPFEVEASKSNLNYVRLDGNVGCMVNGAGLAMGTMDIIQLAGGKPANFLDVGGTASPQ
TVEEGFKIILSDKNVRAILVNIFGGIVRCDRVAGGIMEAAKKMDLHLPVIVRLEGTNASI
AQQMLDESGLSLIAAKGLRDAAQKVQEALA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcatgaatatcaaggcaaggatatcctcagaaaatttggggttaccgtgcca
aaaggcattgtggcttattcggctgatgaagcaaagcaagcagcagagcaactttttgct
gaaacgggttcttccgttgtggttgtaaaagcacaaatccacgcaggtggacggggtaaa
gcgggtggtgttaaacttgcaaaatcacctgaagaggcatttgaaattgctcgccaaatg
attggcatgacgcttattacgcatcaaaccggtcctgaaggtaaagtggtaagtcggctg
cttattgaagagggcatgggaattgaaaaagaattttacgttggcatcacgcttgatcgt
gctacctcacgcaatgtgttgatggtatcaacggaaggtggtatggaaattgaaaccgtt
gccgaagaaacacctgaaaagctcctaaaaattcaaattgacccgcttttcggcatgcaa
ggctttcaagctcgcgaagccgcatttttccttgggcttgagggtgaacagttccgcaat
gccgtaaattttattacagctctttataaagcttacacctcaattgatgcctcagtggct
gaaattaatcctttagtggttacttctgaaggcaaggtgattgctttggacgcaaagatt
aattttgatgataacgccctctatcgccataaagagtacatggaattgcgcgacaccagc
gaggaagatccatttgaagttgaagcttcaaagtctaacttgaactatgtgcgccttgat
ggtaatgtgggctgcatggtgaatggcgctggcttagcaatgggcacgatggatattatt
cagcttgctggtggtaaacctgcaaactttcttgatgttggtggcacagcaagtcctcaa
accgtagaagaaggctttaagattattttaagcgataaaaatgttcgtgctattttagtg
aacatttttggaggcattgtacgctgcgaccgtgtagctggaggtattatggaagctgcc
aagaaaatggatttacacttgcccgttattgtgcgccttgagggcacaaatgcgtccatt
gcacagcaaatgcttgatgaatcgggcttaagcttaattgcggctaaggggttgcgtgat
gcagctcaaaaggtgcaagaagcattagcttaa

DBGET integrated database retrieval system