KEGG   Chlorobium chlorochromatii: Cag_0497Help
Entry
Cag_0497          CDS       T00290                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cch  Chlorobium chlorochromatii
Pathway
cch00010  Glycolysis / Gluconeogenesis
cch00051  Fructose and mannose metabolism
cch00562  Inositol phosphate metabolism
cch01100  Metabolic pathways
cch01110  Biosynthesis of secondary metabolites
cch01120  Microbial metabolism in diverse environments
cch01130  Biosynthesis of antibiotics
cch01200  Carbon metabolism
cch01230  Biosynthesis of amino acids
Module
cch_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cch00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cag_0497
   00051 Fructose and mannose metabolism
    Cag_0497
   00562 Inositol phosphate metabolism
    Cag_0497
Enzymes [BR:cch01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cag_0497
Exosome [BR:cch04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cag_0497
  Exosomal proteins of bladder cancer cells
   Cag_0497
  Exosomal proteins of melanoma cells
   Cag_0497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABB27770
UniProt: Q3ATA5
Position
580210..580968
Genome map
AA seq 252 aa AA seqDB search
MRKKIVVGNWKMNNGVAASEQLAADLLAALGSSFTGCDVGIAPTFLSLTTAGKVIAGSTI
QLVAQNCHYENDGAYTGEVSAAMLKGAGCSSVIIGHSERRQFFGETNATVNLRVKKALAE
GLDVILCVGETLAERESGVTGDIVSAQVREGLVGVSDISNVVIAYEPVWAIGTGKTATSA
QAEEVHLMIRTLVTELYGEPAAQALRIQYGGSVKPSNAVELFAMPNIDGGLIGGASLNAA
DFVAIVQAAAGK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaaaaattgttgttggcaattggaaaatgaataacggtgttgccgcttccgag
caacttgccgccgatcttcttgccgcgttaggcagcagctttactggctgtgatgttggt
attgcgcctacctttctttcccttacaacggctggtaaagtaattgctggctcaactatt
cagcttgtagcgcaaaattgccattatgaaaatgatggtgcttatacgggcgaagtttcc
gcagcaatgctgaaaggagcaggatgtagctcagttattattgggcattcagaacgccgc
caattttttggcgaaaccaatgccaccgttaacctgcgtgtaaaaaaagcgttagccgaa
gggcttgatgttattttgtgtgttggcgaaaccttagccgagcgcgaaagcggtgttacc
ggcgatattgtgtcagcgcaagtacgtgaaggattagttggtgtaagcgatatcagtaac
gtggtaattgcttatgagccagtgtgggcaattggtaccggtaaaacagcaacttccgca
caagccgaagaggtgcacttgatgattcgcaccttagtaacggagctttatggcgagcca
gccgcacaagctttgcgcattcagtatggcggtagtgtaaagccctccaatgcggttgag
cttttcgctatgccaaatattgatggtggcttaattggtggagccagcttaaatgctgcc
gattttgtggctattgtgcaggcagcagcagggaagtaa

DBGET integrated database retrieval system