KEGG   Chlorobium chlorochromatii: Cag_0787Help
Entry
Cag_0787          CDS       T00290                                 

Definition
(GenBank) Alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
cch  Chlorobium chlorochromatii
Pathway
cch00730  Thiamine metabolism
cch00790  Folate biosynthesis
cch01100  Metabolic pathways
cch02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cch00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Cag_0787
   00790 Folate biosynthesis
    Cag_0787
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Cag_0787
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cch04147]
    Cag_0787
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cch00537]
    Cag_0787
Enzymes [BR:cch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Cag_0787
Exosome [BR:cch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cag_0787
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cch00537]
 Enzymes
  Cag_0787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase
Motif
Other DBs
NCBI-ProteinID: ABB28053
UniProt: Q3ASH2
Position
complement(1104851..1106185)
Genome map
AA seq 444 aa AA seqDB search
MFSKKIIRDAGIGLFLLGLSNGAHAVTHLASVPKPKIGNVIFMHPDGTSVSHWTAARMAI
AGPDGTINWDRLPAMAVYRGHMKNSTGATSHGGATTHAFGVKVDADSYGMDRDRALTALS
GKPMSIMREALAAGLAVGVVNSGNIDEPGTGVFLASSRSRKDGQAIAEQIIYSGAQVIMS
GGERWLLPKGVKGRHGEGERSDGKNLIDVAQTLGYTIVYNRDELANLPKDTKRVLGVFAH
HHTFFDHPEEELQKQKLPLYVANAPTVGEMTDAALRILSNQGKRFLLVVEEEGTDNFGNV
NNAVGTLEALRRADAAYGVARSYVQRNPATLLLTAADSDASGLEVVSVAPDVAMKPLNKT
THNGAPLDGRTGTQSLPFIAEADQFGNRLPFGIAWTDMNDGAGGILARAEGINSEALRSG
SCDNSDVYRLMYLTLFGRSADSKK
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgttctctaagaaaataattcgtgacgctggtattggcttatttttattggggttaagt
aatggtgctcatgccgttacccatttagcttctgtaccaaaaccaaaaattggaaatgta
atttttatgcatcctgatggtaccagtgtttcgcattggacggctgctcgtatggctatt
gctggacctgatggcaccatcaattgggatcgcttacctgcaatggctgtgtatcgtgga
cacatgaaaaattcgactggcgcaacatcacatggtggagcaacaacccatgcttttggg
gtaaaagtagatgctgattcgtatggcatggatcgtgatcgcgcgcttactgctctttcg
ggtaaaccaatgagcattatgcgcgaggctctcgctgctggattagcggttggagtggtt
aattcaggtaatattgatgagcccggtacaggcgtatttttagcttcatcgcgtagccgt
aaggatgggcaagcaattgctgagcaaataatttacagtggtgcgcaggttattatgtcg
ggaggtgagcgttggcttttgccgaaaggggttaaagggcgtcatggagagggtgagcgc
agtgatggcaaaaatcttattgatgtagcacagactcttggttatactattgtgtataac
agagatgaattagcaaatcttcctaaagatacgaagcgggtacttggtgtatttgcacat
catcatactttttttgatcaccctgaagaggaattacaaaagcaaaaattaccactctat
gttgccaatgctccaacagttggtgaaatgaccgatgctgcgttgcgtattttatcgaat
caggggaaacggtttttattagtggttgaagaagagggaacggataattttgggaatgtg
aataatgccgtaggtacccttgaggcgcttcgtcgtgctgatgctgcttacggggttgcg
cgttcttatgtacaacgcaatcctgcaacattgttgcttacggctgctgatagtgatgca
agtggtttagaggttgtgtcggttgctcctgatgtagcaatgaagccactgaataaaacc
acgcataatggtgcacctttagatggacgtacaggtacacaatcgttgccatttattgcc
gaagccgatcaatttggtaatcgcctaccttttggtattgcttggactgatatgaacgat
ggggctggtggtattcttgcgcgagctgagggcataaattctgaagctttacgaagtggt
agttgcgataatagcgatgtgtatcgccttatgtacctaacactttttggacgttcagcc
gatagcaagaagtaa

DBGET integrated database retrieval system