KEGG   Chlorobium chlorochromatii: Cag_1720Help
Entry
Cag_1720          CDS       T00290                                 

Definition
(GenBank) thioesterase, menaquinone synthesis protein
  KO
K08680  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [EC:4.2.99.20]
Organism
cch  Chlorobium chlorochromatii
Pathway
cch00130  Ubiquinone and other terpenoid-quinone biosynthesis
cch01100  Metabolic pathways
cch01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cch00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Cag_1720
Enzymes [BR:cch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     Cag_1720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 Thioesterase Esterase PGAP1 Peptidase_S9 Abhydrolase_2 Abhydrolase_3 DLH FSH1 Ndr
Motif
Other DBs
NCBI-ProteinID: ABB28971
UniProt: Q3APV4
Position
complement(2234049..2234846)
Genome map
AA seq 265 aa AA seqDB search
MIMQPPLHIEIIGNKALPKIVFLHGFLGSGRDWLPLAEMLTSHYCCVLVDLPGHGSATLS
ASDEHHAYFTATVEALATVIQPISPEPCRLVGYSMGGRIALALMLTHPELFHQAVIVSAS
PGLPTEEERAKRRAGDEGIARKIERNFPDFLEAWYQQPLFSTLKNHPLFQEIERKRAINN
SESLAAALRLLGTGQQPSFWDALSKCAVPTLFIAGEKDERYVAIARQMVKLAPHATLSIV
PNCGHTLHIENKESFVEQLHTFFNQ
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgataatgcagccaccactccacattgaaataattggcaataaagcgttaccgaaaatt
gttttcctgcacggctttcttggttcgggacgcgattggctgcctcttgctgaaatgctt
acaagccactattgctgtgtgttggttgatttgcccggacatggcagtgcaacgctgagc
gcaagtgatgagcatcacgcttattttacggcaacagtggaggcgcttgcaacggtaatt
cagccaatcagccctgagccttgccgacttgtgggctattcaatgggcggacgtattgcc
ttagcgctcatgcttacccatcccgaacttttccatcaagcggtgattgtttcagcttca
ccgggcttgccaacagaggaggagcgtgcaaagcgtcgggcaggtgatgagggcattgcg
cgtaaaattgagcgcaacttccccgattttttggaggcgtggtaccagcagcctcttttt
tccaccttaaaaaatcatcccctttttcaagaaatagagcgtaaacgcgctatcaacaat
tccgaaagccttgcggcggcgcttcgtttgttgggtacaggtcagcagccgtcgttttgg
gatgcactgagcaaatgtgctgtaccaacgctctttattgcgggagaaaaagatgagcgc
tacgttgcgattgcccgccaaatggttaagttagcgcctcacgcaaccctctccattgtg
cccaactgtgggcatacgcttcacattgaaaacaaggagagttttgtggaacaactccac
actttttttaaccaataa

DBGET integrated database retrieval system