KEGG   Caldicellulosiruptor changbaiensis: ELD05_05730Help
Entry
ELD05_05730       CDS       T05905                                 

Gene name
coaBC
Definition
(GenBank) bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
ccha  Caldicellulosiruptor changbaiensis
Pathway
ccha00770  Pantothenate and CoA biosynthesis
ccha01100  Metabolic pathways
Module
ccha_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:ccha00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ELD05_05730 (coaBC)
Enzymes [BR:ccha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     ELD05_05730 (coaBC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     ELD05_05730 (coaBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein PspC DUF2507
Motif
Other DBs
NCBI-ProteinID: AZT90177
UniProt: A0A3T0D544
Position
1180708..1181910
Genome map
AA seq 400 aa AA seqDB search
MSLKNKNILIGICGGIAAYKVCELIRFLKKSEANVKVIMTNNAQRFITPLTVQTLSQNRV
YLDTFESEYFYDIEHISLTAWADILVVAPATANIIGKFANGIADDLLTTTFLAFNKPILV
VPAMNSNMFENKIVQANIQKLKQVGINVLEPEAGLLACGVYGKGRYPENRKIVIEIERLL
EKKDLDGKRVLITAGPTREYLDPVRFISNRSSGKMGFALAEEAYKRGAKVTLVSGPVNIQ
TYADIEIVNVETAYEMYEEVKSIKDKYDILIFSAAVADFKPKNFRESKIKKEQEQELQIE
LQKNPDILKYAGETKKDWQIVVGFSAETENLIENSKKKLYEKNADLIVANNVLQEGAGFN
VDTNIVTLISKEKVLELPKLSKEEVAGRIFDFIVDYLCRR
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagtctaaaaaataaaaacatcttgataggaatatgtggcgggattgcagcatataaa
gtgtgtgagcttataaggtttttaaaaaagtctgaggcaaatgtaaaggtaattatgacc
aataatgcacaaaggtttataactcctttgacagtgcaaactctttcgcaaaacagagtt
tatcttgacacatttgaaagtgagtatttctatgatatagagcacatatcattgacagcc
tgggcagatatcttagttgtagctcctgcaacagcaaatattattggaaagtttgcaaat
ggcattgctgatgaccttttgacaaccacttttttagcattcaataagcccattttagtt
gttcctgcaatgaattcaaacatgtttgaaaacaaaattgtgcaggcaaatatacaaaag
ctaaagcaggttggcataaatgttttagaacctgaagcagggcttttagcttgtggagta
tatgggaaaggacgttatcctgaaaaccgaaaaattgtaattgaaattgaaaggctgctt
gaaaaaaaagatttagatggcaaaagggttctcatcacagccggcccaacaagagaatac
ttagatcctgtgaggtttatttctaacaggtcatcaggtaagatgggttttgcattagca
gaagaagcctataaaagaggagcaaaagttactctcgtatcaggtcctgtaaacattcaa
acttatgcagacatcgagatagttaacgttgagacagcttatgagatgtatgaagaagta
aaaagtataaaggataaatatgatatactcatattctctgctgcagttgcagactttaaa
ccaaaaaactttagagaatcgaaaataaaaaaggaacaagaacaagaactacagattgaa
cttcagaaaaatcctgacattttaaaatatgcgggggagactaagaaggattggcaaatt
gttgtaggattttcggctgagacagaaaatctaattgaaaattccaagaaaaaactttat
gagaaaaatgcagatttgattgttgctaacaatgttttacaagaaggtgctgggtttaat
gtggatacgaacattgtcacgctaatctcaaaagagaaggttttagagcttcctaaactt
agcaaagaggaagtggcaggcagaatatttgacttcatagtagattacctctgcagaagg
tag

DBGET integrated database retrieval system