KEGG   Caldicellulosiruptor changbaiensis: ELD05_07005Help
Entry
ELD05_07005       CDS       T05905                                 

Definition
(GenBank) PHP domain-containing protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
ccha  Caldicellulosiruptor changbaiensis
Brite
KEGG Orthology (KO) [BR:ccha00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ELD05_07005
Enzymes [BR:ccha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     ELD05_07005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AZT90412
UniProt: A0A3T0D673
Position
complement(1435824..1436519)
Genome map
AA seq 231 aa AA seqDB search
MKLYYDLHIHSALSPCADNDMTPNNIINMAKIKGLNVISITDHNSTLNLKEFLEVAKHLG
ILFIPGVEIETCEEVHVLLYFKDFSVVEEFQEIIEENLPNIALREDIYGNQFLVDKEDNI
VGSYKKLLLQPLNLSIFQVYEISKFYNMIFVPAHINRQSYGIIGRLGTLPDELKDVSLLE
VSKVNEFEFTNLLPKDSRYIFLHSSDAHHLWDINEKEFFIESDILYTIFFK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctattatgacctgcacattcactctgcgctctcaccttgtgctgacaatgac
atgaccccaaataatataataaacatggcaaagataaagggactaaatgtaatttccata
acagaccataattctacattgaatttgaaagagttcttagaggttgcaaaacatcttggg
attttatttatcccaggtgttgagatagaaacttgtgaagaagtccatgttcttttatat
ttcaaagatttctctgtagtggaagagtttcaagagattattgaagaaaaccttccaaac
atagccttgagagaggatatatatggaaatcagttcttagtggacaaggaagacaatatt
gtcggaagctataaaaaacttctgctccaaccactgaatttaagtatatttcaagtttat
gaaatttcaaagttttacaatatgatttttgttccagctcatatcaatagacaatcctat
ggaataattggaaggctgggaacattaccagatgaactaaaagatgtttctcttttagaa
gtttcaaaagtcaatgaatttgaatttacaaatcttttgcccaaagatagcaggtacatt
tttttacactcttctgatgcacatcatctatgggatattaacgaaaaggagttttttatt
gaaagtgatatactgtatacaatatttttcaagtaa

DBGET integrated database retrieval system