KEGG   Caldicellulosiruptor changbaiensis: ELD05_13325Help
Entry
ELD05_13325       CDS       T05905                                 

Definition
(GenBank) glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
ccha  Caldicellulosiruptor changbaiensis
Pathway
ccha00511  Other glycan degradation
ccha00600  Sphingolipid metabolism
ccha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccha00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    ELD05_13325
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ELD05_13325
Enzymes [BR:ccha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     ELD05_13325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_59 Glyco_hydro_30C Melibiase SLBB
Motif
Other DBs
NCBI-ProteinID: AZT91498
UniProt: A0A3T0D929
Position
complement(2780752..2782092)
Genome map
AA seq 446 aa AA seqDB search
MHKTIACYITAKYQDIPMQQVDNIKECEKIKEKTVITIEPSTTFQEVIGFGGALTEAAAV
NIMSLLPHQQEEILRGYFDPEKGLGYKLCRIHMNSCDFCTGSYSCDDVEGDTDLKHFNIE
RDKKMVIPLLKRIKEYCPDLKILVSPWSPPAWMKTNADMCHGGKLKDEYKKTWARFFCKF
IKAYKEEGIEIWAVTVQNEPMATQVWESCIYTAEEERDFVKDYLGPTLKEEGLSHIKILI
WDHNKDIIYERVKTILSDKEAAKYVWGVAFHWYGGDHFDQLKKIKEKFPDVNLVFTEGCQ
EGGVKLGSWELGERYAHEIIGDFSSYTIGFMDWNIVLDTVGGPNHVGNFCDAPIIVDKDQ
KKIYYQNAYYYIGHFSKFIKPGAKIVKSSCSSSRLEVLAAKNGDDTLAVVVLNKNPEEIE
FNMVIEDKIFCGNSPARSISTIVLEK
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaacaattgcatgttacataacagcgaaatatcaggacattccaatgcagcag
gtagataatataaaagaatgtgagaaaataaaagagaaaactgttataacaattgagcca
tccactacatttcaagaggtaataggctttggtggagcactcactgaagctgccgcggta
aatataatgtcacttttgccacaccagcaagaagagattttaagagggtactttgaccct
gaaaaggggcttggctacaaactctgtagaatccacatgaacagctgtgatttttgtaca
ggcagctacagctgtgatgatgttgaaggtgataccgatctaaaacattttaacattgaa
agagacaaaaagatggtaattcctcttttaaaaagaataaaggaatattgtccagatctc
aaaatcctcgtttcaccatggagtccgcctgcatggatgaagacaaacgctgatatgtgc
catggtggaaagctaaaggatgagtataaaaaaacatgggcaaggtttttctgcaaattc
ataaaagcatataaagaagaaggaattgagatatgggctgtgacagttcaaaatgagcca
atggcaactcaagtgtgggagtcgtgcatatacaccgctgaagaggaaagagattttgtg
aaggattacttaggaccaactcttaaagaagaagggctttcccatataaaaatacttata
tgggaccacaacaaagatatcatatatgagagagtaaaaacaattttaagtgacaaagaa
gctgctaagtatgtatggggagttgcatttcactggtatggaggagaccattttgaccag
ctcaaaaaaataaaagaaaagtttccagatgtgaatttggtgtttaccgaaggttgtcag
gaaggtggagtaaagcttggttcctgggagcttggtgaaaggtatgctcatgagataatt
ggcgattttagcagctacacgattggatttatggattggaatattgttcttgacacagtt
ggaggccccaatcatgttggaaacttttgcgatgcaccgataattgttgataaagaccag
aaaaagatttactaccaaaatgcgtattattatatagggcatttttctaaattcataaaa
ccgggagctaaaatagtcaaaagcagctgcagtagttcaagacttgaggttttggcagca
aagaatggggatgatactttggcggtagttgtgctaaataaaaacccagaggaaatagag
tttaatatggtcattgaagataaaatattctgtggaaactccccagcaaggtctatatca
actattgttctggaaaaataa

DBGET integrated database retrieval system