KEGG   Clostridium chauvoei: BTM20_07260Help
Entry
BTM20_07260       CDS       T05083                                 

Definition
(GenBank) aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cchv  Clostridium chauvoei
Pathway
cchv00051  Fructose and mannose metabolism
cchv01100  Metabolic pathways
cchv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cchv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BTM20_07260
Enzymes [BR:cchv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BTM20_07260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II TcpS
Motif
Other DBs
NCBI-ProteinID: ATD55045
Position
1605616..1606410
Genome map
AA seq 264 aa AA seqDB search
MISEYEVKKQMCEIGKRIYMNGFVAANDGNLSVKINDKEVLCTPTGVSKGYMTPDMICKV
DINGNIITANGKFKPSSEIKMHLRVYKERPDVSSVVHAHPPYGTSYAIAGIPLDKAIMPE
AVIALGNVPIAEYGTPSTDEIPDAVSKYLQCYDAVLLENHGALTYGPDLMGAYFKMESLE
FYAKLMFISSQIGEPQVLNNKQVDKLLDIRKNMNLIGKHPGLCCKDGDCKYNSKNIEDKQ
NKIEDYEIEKIVKEVTAKILGAIK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgatatcagaatatgaagttaaaaagcaaatgtgtgaaattggaaaaagaatttatatg
aatggatttgttgctgctaatgatgggaacttatcagttaaaattaatgataaagaggtg
ctttgtacaccaactggtgtttcaaaagggtatatgacaccagatatgatatgtaaagtt
gatattaatggtaatattataactgcaaatggaaagtttaaaccttcttcagagataaaa
atgcacttaagagtttataaagaaagacctgatgttagttcagtagtacatgcccatcca
ccatatggtacaagctatgccattgctgggattcctttagataaagctattatgcccgag
gctgttatagctttaggtaatgttccaatagctgaatatggtacaccatcaacagatgaa
attccagatgctgtatcaaaatatttgcaatgttatgatgctgttctccttgaaaaccat
ggtgctttaacatatgggccagatttaatgggagcttattttaaaatggaatcattagaa
ttctatgcaaagttaatgtttatatctagtcaaattggcgaaccacaagttttaaataac
aaacaagttgataaattattagatataagaaaaaatatgaatttaataggaaaacatcca
ggtttatgttgtaaagatggggattgtaaatataattcaaagaatatagaagataaacaa
aataaaattgaagattatgaaatagaaaagatagtaaaagaagttactgctaaaatatta
ggagctattaaataa

DBGET integrated database retrieval system