KEGG   Coprinopsis cinerea: CC1G_00296Help
Entry
CC1G_00296        CDS       T01275                                 

Definition
(RefSeq) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
cci  Coprinopsis cinerea
Pathway
cci03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cci00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CC1G_00296
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cci03011]
    CC1G_00296
Ribosome [BR:cci03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CC1G_00296
  Bacteria
    CC1G_00296
  Archaea
    CC1G_00296
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22 PUB_1
Motif
Other DBs
NCBI-GeneID: 6013716
NCBI-ProteinID: XP_001837160
UniProt: A8NXG3
Position
5
AA seq 244 aa AA seqDB search
MQSYATDYSAALGRKSLLNNVASSSRFASAWSPVNWVREKLAPGVNEKASEKEVAAAKQA
ARAQGTTSVFETLPQAITKKAEVVVKEKQKERAAFHKYSTANFKISHRKLNMLANQISSK
PIDYAILQMQFSEKRAGRRIMNMLCTAKDHAIRYKKLDPSRLVVSQAWVTKGPRPPKQVE
PRGRGHYGIRIKNNAKMTVVLSYGKSIEEKKAEEFKKKLKKAVSPHMHLREDIPLRNPSR
GWTW
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgcagagctatgctactgactacagcgcagctttgggcaggaaatcgcttttgaacaac
gttgcctcctcgtcccggtttgcctcagcatggagtcctgttaactgggtcagagagaag
ctggcccctggcgtgaacgagaaggcgtccgagaaggaggtcgctgcagccaaacaggct
gctcgtgctcaagggaccaccagtgttttcgaaacgctgccgcaagctatcacgaagaaa
gcagaagtggtggtgaaagagaaacagaaggagcgggccgcctttcacaaatactcgacc
gccaacttcaagatctcccataggaaactaaacatgcttgccaaccaaatttcttccaag
cctatcgactatgccatcttgcaaatgcaattcagcgaaaagagagctggtaggcggata
atgaacatgctttgcacggccaaggaccatgccattcgttacaagaagttggacccctcg
cgcttggttgtctctcaggcatgggtgaccaagggcccacgaccaccgaaacaagtggaa
cccagaggtcggggtcactatggtattcgtatcaagaacaacgccaagatgactgttgtc
ctgtcgtacggcaagtcaatcgaagaaaagaaggccgaagagttcaagaaaaagctcaag
aaggccgtttctcctcatatgcatctcagagaggacatccccttgcgcaacccctctcga
gggtggacctggtag

DBGET integrated database retrieval system