KEGG   Coprinopsis cinerea: CC1G_00829Help
Entry
CC1G_00829        CDS       T01275                                 

Definition
(RefSeq) 3-demethylubiquinone-9 3-methyltransferase
  KO
K00568  2-polyprenyl-6-hydroxyphenyl methylase / 3-demethylubiquinone-9 3-methyltransferase [EC:2.1.1.222 2.1.1.64]
Organism
cci  Coprinopsis cinerea
Pathway
cci00130  Ubiquinone and other terpenoid-quinone biosynthesis
cci01100  Metabolic pathways
cci01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cci00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    CC1G_00829
Enzymes [BR:cci01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.64  3-demethylubiquinol 3-O-methyltransferase
     CC1G_00829
    2.1.1.222  2-polyprenyl-6-hydroxyphenol methylase
     CC1G_00829
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_11 Methyltransf_12 Methyltransf_25 Methyltransf_31 CMAS PrmA MTS TehB Methyltransf_32 Methyltransf_9 MetW TPMT
Motif
Other DBs
NCBI-GeneID: 6007749
NCBI-ProteinID: XP_001831282
UniProt: A8N8V4
Position
7
AA seq 322 aa AA seqDB search
MSLRFLRPRLPRTPSASTAKRSLHASKPARTVGTTVNQDEISHFSRLSSEWWDEQGEFSF
LHRMNPTRVQFIQEKLAEIASDENKNGSIVDPRAVLQGLDVLDVGCGGGLLSESLARLGA
NTTGIDASEANIGIASLHASADPALRSGGNLKYLHTTTGDLLTPSPSTPTQPPKQYDVVA
SLEVLEHVDNPAHFLDTCCQLVKPGGHLFLSTIARTPLAYTLTILMAEHVLGKVSKGTHT
WSKYVNPDELVEFFKNYPEGAPKDQKWISPDASTYLPRHQAELKGLIYNPLSGNWSLGPR
NLFAAAQCNYIFWVRKPHETAS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttcgctttcttaggcctcgactaccgcgaacgccctcggcatccacagcgaaa
cgcagtctccacgcatccaaaccagctagaacagtagggacgaccgtcaaccaagatgaa
atatcgcatttctcgcgtctctcatccgagtggtgggacgagcaaggcgaattctcgttc
cttcacaggatgaaccccactcgtgtgcagtttatccaagaaaagctggcagagatagct
tcagacgaaaacaaaaatggttccattgtcgacccacgggcagtgctgcaaggacttgac
gtcttggacgtgggatgtggaggtgggctattgtctgagagcctggcacggctaggtgcc
aacaccacaggaattgacgcatctgaagcgaacattggcatcgcgtctttgcatgcctcc
gccgatcctgctctgcgttccggtggaaacctgaaatacctccacaccacaactggggac
cttttgaccccatctccttcaactccaacgcaaccaccaaagcaatacgacgttgtagct
tcgctcgaagtgctcgaacatgttgacaaccccgcgcatttcctcgacacctgttgccaa
ctcgtgaagccaggaggtcatctgttcctctccacaatagctcgaacacctctcgcctac
accctgaccatccttatggccgaacatgtcctcggaaaggtctcaaaggggacgcatacc
tggagtaaatacgtcaatccagatgagcttgtcgagttcttcaaaaactatcctgaagga
gcacccaaagaccagaagtggatttcaccagacgcatcgacatacttgcctcggcaccaa
gcagagctcaaagggcttatttataatccattaagcggcaattggagtcttggaccccgc
aatctgttcgccgctgctcagtgcaactacatcttttgggtccgaaaacctcacgagact
gcgtcataa

DBGET integrated database retrieval system