KEGG   Coprinopsis cinerea: CC1G_01080Help
Entry
CC1G_01080        CDS       T01275                                 

Definition
(RefSeq) hypothetical protein
  KO
K15435  2',3'-cyclic-nucleotide 3'-phosphodiesterase [EC:3.1.4.37]
Organism
cci  Coprinopsis cinerea
Brite
KEGG Orthology (KO) [BR:cci00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cci03016]
    CC1G_01080
Enzymes [BR:cci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.37  2',3'-cyclic-nucleotide 3'-phosphodiesterase
     CC1G_01080
Transfer RNA biogenesis [BR:cci03016]
 Eukaryotic type
  tRNA spricing factors
   Other tRNA splicing factors
    CC1G_01080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPDase 2_5_RNA_ligase2 LigT_PEase
Motif
Other DBs
NCBI-GeneID: 6009509
NCBI-ProteinID: XP_001833018
UniProt: A8NEG2
Position
2
AA seq 212 aa AA seqDB search
MWLISFFHHRKHFIMSKINLWLMPSREDGERLKSIMAPLHDTTGVQPSSYPPFDPHVTLG
SFIDEETDREALKVLLSKIPPPTVPFKSIEVGTHYFRSVFIAVEPTRELVDLQFKFNRGE
TTPLYPHVSLAYIADEDSEKGERKRYFEGLVNAGKIRERDGGKGVEIRCKNGINGEEDWM
SSYLATEVWFVKCVGAVQEWKVEEKVGLGGEK
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcatcagtttcttccaccatcgtaaacattttataatgtctaaaattaatctc
tggcttatgccctcccgagaagacggcgagagactaaagtcgatcatggctccgctgcat
gacacgaccggcgtccaacccagttcataccctcccttcgacccacacgtaactctcgga
agcttcatcgacgaagagacagaccgagaagctctcaaagtattgttatccaagatacct
ccaccaaccgttccgttcaaatcaatcgaagtaggaacgcactactttcggagcgtcttc
atcgccgtcgaacctactcgtgaacttgtggatcttcaattcaagttcaataggggcgaa
acgactcctttgtacccgcatgtatcgctggcgtatatagcggacgaggactcagagaag
ggcgagaggaagaggtattttgaggggctggttaatgcggggaaaataagggagagggat
ggcgggaagggtgtggagattcggtgtaagaatgggattaacggggaagaggactggatg
agttcgtacctcgcaactgaagtttggtttgtcaagtgtgtcggtgctgtgcaagagtgg
aaagttgaggagaaagttggcttgggcggggagaagtag

DBGET integrated database retrieval system