KEGG   Coprinopsis cinerea: CC1G_04438Help
Entry
CC1G_04438        CDS       T01275                                 

Definition
(RefSeq) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
cci  Coprinopsis cinerea
Pathway
cci00260  Glycine, serine and threonine metabolism
cci01100  Metabolic pathways
cci01110  Biosynthesis of secondary metabolites
cci01130  Biosynthesis of antibiotics
cci01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cci00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CC1G_04438
Enzymes [BR:cci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CC1G_04438
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 OKR_DC_1 Nbs1_C
Motif
Other DBs
NCBI-GeneID: 6004891
NCBI-ProteinID: XP_001828467
UniProt: A8N0L7
Position
1
AA seq 405 aa AA seqDB search
MATTAANGTALSNVVDELKLDLLTVNHVEENAKKRKEIARTFISDTVTVPTEEMYAYAVQ
ATLGDDVYHDPSTAALEAHIAKITGKEAALFVPSGTASNQIAIRTHLTQPPYSVLVDKRA
HINQYEAGGTAFHSGAHLIPVAPSNRHHLTLEDIQENAVVSSDIHCAPTTLIALENTLNG
SIFPQSEILRIADYAKSINAKLHLDGARIWHVAVETETSVKELCEPFDSVSVCFSKGLGA
PVGSCLAGPKAFIQKARWFRKLFGGGMRQTGILAASAAYALTHNLPQLSRVHTLAKRLQS
GLEDIGVKILSEAETCMIFYDPSTVGVTYEEIADRGYALNEPLILGGSRLVVHIQTSEAA
VEDFLSVVRQLAQEKKDAGFVYQLDEQTNGAFKDVYVRRAPKVAK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggctaccaccgctgcgaatggaactgccctgtcgaatgtcgtcgacgagttgaagcta
gacttgttgactgtgaaccatgtagaggagaatgcgaagaagaggaaggaaattgctcgg
acgttcatttcggacaccgtaacggttcccactgaggaaatgtacgcctacgccgttcag
gcaaccctgggtgacgacgtctatcacgacccttccaccgctgcactagaagcacacatc
gccaaaatcacaggcaaagaagcagccctcttcgtcccctccggaacagcctccaaccaa
atcgcaatccgaacccacctcacccaaccaccctactcagtgctagtcgacaaacgcgca
cacatcaaccaatacgaagccggtggaaccgcctttcactccggcgcccacctgatcccc
gtcgcaccttcaaaccgacaccacctcactctcgaagacatccaagagaacgccgtcgtc
agctctgatatccactgcgctcctacaacattgatcgccctagaaaacacactcaatggg
agtatctttccccagtctgaaattctgcgtatcgcggattacgccaagtctatcaacgcc
aaactgcatcttgacggagcgcggatatggcacgtcgcggtggagacagagacgagtgtg
aaggagctttgtgaaccctttgactcggttagtgtgtgtttcagcaaggggcttggcgcc
ccggtaggctcgtgccttgcaggcccgaaggctttcatccaaaaagcacggtggttccgt
aaactctttggaggaggcatgcgacagacgggtatcctcgctgcgtctgcggcatacgct
cttacgcacaacctacctcaactctctcgcgtccacactctcgccaaacgtctgcagagt
ggcctagaggacatcggagtgaaaatcctaagcgaggctgagacttgtatgatcttctac
gacccctctacagtcggcgtaacctacgaagaaatcgcggacaggggatacgcgctgaac
gaaccattgatcctgggtggctcccgtctcgtcgtccatatccagacctcagaagcagct
gttgaggacttcctatccgtcgttcgacaactggcccaggagaagaaggatgcaggattt
gtgtaccaacttgacgagcaaaccaatggagcattcaaggacgtatacgttaggagagca
cctaaagttgcgaagtag

DBGET integrated database retrieval system