KEGG   Coprinopsis cinerea: CC1G_04976Help
Entry
CC1G_04976        CDS       T01275                                 

Definition
(RefSeq) thiazole biosynthetic enzyme
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
cci  Coprinopsis cinerea
Pathway
cci00730  Thiamine metabolism
cci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cci00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CC1G_04976
Enzymes [BR:cci01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     CC1G_04976
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thi4 DAO Lycopene_cycl Pyr_redox_2 NAD_binding_8 FAD_binding_2 FAD_oxidored NAD_binding_9 HI0933_like GIDA Pyr_redox_3 Trp_halogenase
Motif
Other DBs
NCBI-GeneID: 6012523
NCBI-ProteinID: XP_001835983
UniProt: A8NSD1
Position
8
AA seq 313 aa AA seqDB search
MAPALTLEKPVETNAFPRKAASVETSENYEGNYKFAPIEEAQVSRAMIKRYFNTMYDRAI
SDVVIVGAGSAGLSCAYSLATQRPDLKITIVEAGVAPGGGAWLGGQLMTPMVIRKPADAF
LRELGVPYEDEGNFVVVKHAALFTSTLLSKVLAKPNVVMMNATAVEDLIVHEDFAGQQRV
AGVVTNWTLVALNHDTQSCMDPNTITAPVIVSATGHDGPMGAFSAKRLVSTGLLKELGNM
RGLDMNRAEPAIVNGTREVVPGLILTGMELSEHDGSNRMGPTFGAMIGSGHKAAHEAIRI
LDRHKVVNGKVVA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcccctgcactcaccctcgagaagcccgtcgaaaccaacgccttccctcgcaaggct
gcgtccgtcgagacgtctgagaactatgagggcaactacaagttcgcccccatcgaggaa
gcgcaagtctcccgggctatgatcaagcgatacttcaacaccatgtacgatcgggccatc
tccgatgtcgtcattgttggtgcaggaagcgctggattgtcctgcgcttacagtctcgct
acccagcgacctgacttgaaaatcaccatcgtcgaggctggtgttgcccccggtggtggt
gcatggctcggtggccagctgatgactcctatggtcatcagaaagcccgctgacgcgttc
ctccgcgagctcggcgtcccctacgaggacgagggcaacttcgtcgtcgtcaagcacgcc
gccctcttcacctccaccctcctctccaaggtcctcgccaaacccaacgtcgtcatgatg
aacgccaccgccgtcgaggacctcatcgtccacgaggacttcgccggccagcagcgcgtt
gctggtgtcgtcaccaactggaccttggtcgccttgaaccacgacacgcagtcatgcatg
gaccccaacaccatcactgcgcctgttatcgtctcggcgactggccatgatggacctatg
ggtgctttcagcgccaagcgcctcgttagcactggcttgctcaaggagttgggcaacatg
aggggattggatatgaaccgcgctgagcctgctattgttaacggcactcgcgaggtcgtt
cctggtctcattttgactggtatggagttgtcagagcacgacggttcgaacaggatgggt
cctaccttcggtgctatgattggtagtggccacaaggctgcccatgaggctatccgcatc
ttggaccgacacaaggtcgtcaacggcaaggtcgtcgcctaa

DBGET integrated database retrieval system